LOCUS AF103377 304 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens isolate donor D clone D110K immunoglobulin kappa light chain variable region mRNA, partial cds. ACCESSION AF103377 VERSION AF103377.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 304) AUTHORS de Wildt,R.M., Hoet,R.M., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Analysis of heavy and light chain pairings indicates that receptor editing shapes the human antibody repertoire JOURNAL J. Mol. Biol. 285 (3), 895-901 (1999) PUBMED 9887257 REFERENCE 2 (bases 1 to 304) AUTHORS de Wildt,R.M.T., Hoet,R.M.A., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Direct Submission JOURNAL Submitted (29-OCT-1998) Centre for Protein Engineering, MRC, Hills Road, Cambridge CB2 2QH, UK FEATURES Location/Qualifiers source 1..304 /organism="Homo sapiens" /mol_type="mRNA" /isolate="donor D" /db_xref="taxon:9606" /clone="D110K" /cell_type="B cell" /tissue_type="peripheral blood" /note="isolated from patient with systemic lupus erythematosus" CDS <1..>304 /codon_start=3 /product="immunoglobulin kappa light chain variable region" /protein_id="AAD16548.1" /translation="LGERATISCKSSQSVLSNSNNLNYFGWYQQKPGQPPKLLIYWAS TRQSGVPDRFSGSGSGTDFTLTISSLQAEDVAIYYCQQYYSTAWTFGQGTNVEIKRT" V_region <1..>304 BASE COUNT 77 a 79 c 78 g 70 t ORIGIN 1 ctctgggcga gagggccacc atcagttgca agtccagcca gagtgtttta tcgaattcca 61 acaatttgaa ctactttggt tggtaccagc agaaaccagg ccagcctcca aagttgctca 121 tttactgggc atctacccgg caatccgggg tccctgaccg attcagtggc agcgggtctg 181 ggacagattt cactctcacc atcagcagcc tgcaggctga agatgtggca atttattact 241 gtcagcaata ttatagtacc gcgtggacgt tcggccaagg gaccaatgtg gagatcaaac 301 gaac //