LOCUS       AF103377                 304 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens isolate donor D clone D110K immunoglobulin kappa light
            chain variable region mRNA, partial cds.
ACCESSION   AF103377
VERSION     AF103377.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 304)
  AUTHORS   de Wildt,R.M., Hoet,R.M., van Venrooij,W.J., Tomlinson,I.M. and
            Winter,G.
  TITLE     Analysis of heavy and light chain pairings indicates that receptor
            editing shapes the human antibody repertoire
  JOURNAL   J. Mol. Biol. 285 (3), 895-901 (1999)
   PUBMED   9887257
REFERENCE   2  (bases 1 to 304)
  AUTHORS   de Wildt,R.M.T., Hoet,R.M.A., van Venrooij,W.J., Tomlinson,I.M. and
            Winter,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-1998) Centre for Protein Engineering, MRC, Hills
            Road, Cambridge CB2 2QH, UK
FEATURES             Location/Qualifiers
     source          1..304
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="donor D"
                     /db_xref="taxon:9606"
                     /clone="D110K"
                     /cell_type="B cell"
                     /tissue_type="peripheral blood"
                     /note="isolated from patient with systemic lupus
                     erythematosus"
     CDS             <1..>304
                     /codon_start=3
                     /product="immunoglobulin kappa light chain variable
                     region"
                     /protein_id="AAD16548.1"
                     /translation="LGERATISCKSSQSVLSNSNNLNYFGWYQQKPGQPPKLLIYWAS
                     TRQSGVPDRFSGSGSGTDFTLTISSLQAEDVAIYYCQQYYSTAWTFGQGTNVEIKRT"
     V_region        <1..>304
BASE COUNT           77 a           79 c           78 g           70 t
ORIGIN      
        1 ctctgggcga gagggccacc atcagttgca agtccagcca gagtgtttta tcgaattcca
       61 acaatttgaa ctactttggt tggtaccagc agaaaccagg ccagcctcca aagttgctca
      121 tttactgggc atctacccgg caatccgggg tccctgaccg attcagtggc agcgggtctg
      181 ggacagattt cactctcacc atcagcagcc tgcaggctga agatgtggca atttattact
      241 gtcagcaata ttatagtacc gcgtggacgt tcggccaagg gaccaatgtg gagatcaaac
      301 gaac
//