LOCUS AF092878 754 bp mRNA linear HUM 24-JUL-2001
DEFINITION Homo sapiens zinc RING finger protein SAG mRNA, complete cds.
ACCESSION AF092878
VERSION AF092878.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 754)
AUTHORS Swaroop,M., Bian,J., Aviram,M., Duan,H., Bisgaier,C.L., Loo,J.A.
and Sun,Y.
TITLE Expression, purification, and biochemical characterization of SAG,
a RING finger redox-sensitive protein
JOURNAL Free Radical Biol. Med. 27, 193-202 (1999)
REFERENCE 2 (bases 1 to 754)
AUTHORS Duan,H., Wang,Y., Aviram,M., Swaroop,M., Loo,J.A., Bian,J.,
Tian,Y., Mueller,T., Bisgaier,C.L. and Sun,Y.
TITLE SAG, a novel zinc RING finger protein that protects cells from
apoptosis induced by redox agents
JOURNAL Mol. Cell. Biol. 19 (4), 3145-3155 (1999)
PUBMED 10082581
REFERENCE 3 (bases 1 to 754)
AUTHORS Sun,Y.
TITLE Alterations of SAG mRNA in human cancer cell lines: requirement for
the RING finger domain for apoptosis protection
JOURNAL Carcinogenesis 20 (10), 1899-1903 (1999)
PUBMED 10506102
REFERENCE 4 (bases 1 to 754)
AUTHORS Swaroop,M., Wang,Y., Miller,P., Duan,H., Jatkoe,T., Madore,S.J. and
Sun,Y.
TITLE Yeast homolog of human SAG/ROC2/Rbx2/Hrt2 is essential for cell
growth, but not for germination: chip profiling implicates its role
in cell cycle regulation
JOURNAL Oncogene 19 (24), 2855-2866 (2000)
PUBMED 10851089
REFERENCE 5 (bases 1 to 754)
AUTHORS Duan,H., Tsvetkov,L.M., Liu,Y., Song,Y., Swaroop,M., Wen,R.,
Kung,H.F., Zhang,H. and Sun,Y.
TITLE Promotion of S-phase entry and cell growth under serum starvation
by SAG/ROC2/Rbx2/Hrt2, an E3 ubiquitin ligase component:
association with inhibition of p27 accumulation
JOURNAL Mol. Carcinog. 30 (1), 37-46 (2001)
PUBMED 11255262
REFERENCE 6 (bases 1 to 754)
AUTHORS Sun,Y.
TITLE Direct Submission
JOURNAL Submitted (16-SEP-1998) Department of Molecular Biology,
Parke-Davis, 2800 Plymouth Rd, Ann Arbor, MI 48105, USA
FEATURES Location/Qualifiers
source 1..754
/db_xref="H-InvDB:HIT000068373"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="3"
/map="3q22-q24"
/cell_line="HeLa, D98/AH-2, HPRT-"
CDS 1..342
/function="growth promotion"
/note="redox sensitive, metal binding; expression protects
cells from apoptosis induced by redox compounds"
/codon_start=1
/product="zinc RING finger protein SAG"
/protein_id="AAD25962.1"
/translation="MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWD
VECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLC
QQDWVVQRIGK"
BASE COUNT 205 a 155 c 201 g 193 t
ORIGIN
1 atggccgacg tggaagacgg agaggaaacc tgcgccctgg cctctcactc cgggagctca
61 ggctccaagt cgggaggcga caagatgttc tccctcaaga agtggaacgc ggtggccatg
121 tggagctggg acgtggagtg cgatacgtgc gccatctgca gggtccaggt gatggatgcc
181 tgtcttagat gtcaagctga aaacaaacaa gaggactgtg ttgtggtctg gggagaatgt
241 aatcattcct tccacaactg ctgcatgtcc ctgtgggtga aacagaacaa tcgctgccct
301 ctctgccagc aggactgggt ggtccaaaga atcggcaaat gagagtggtt agaaggcttc
361 ttagcgcagt tgttcagagc cctggtggat cttgtaatcc agtgccctac aaaggctaga
421 acactacagg ggatgaattc ttcaaatagg agccgatgga tctgtggtct ttggactcat
481 caaagccttg gttagcattt gtcagtttta tcttcagaaa ttctctgtga ttaagaagat
541 aatttattaa aggtggtcct tcctacctct gtggtgtgtg tcgcgcacac agcttagaag
601 tgctataaaa aaggaaagag ctccaaattg aatcacctta taatttaccc atttctatac
661 aacaggcagt ggaagcagtt tcgagacttt ttcgatgctt atggttgatc agttaaaaaa
721 gaatgttaca gtaacaaata aagtgcagtt taaa
//