LOCUS       AF083213                 389 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens putative zinc finger protein mRNA, partial cds.
ACCESSION   AF083213
VERSION     AF083213.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 389)
  AUTHORS   Holmes,D.I., Abdel Wahab,N. and Mason,R.M.
  TITLE     Identification of glucose-regulated genes in human mesangial cells
            by mRNA differential display
  JOURNAL   Biochem. Biophys. Res. Commun. 238 (1), 179-184 (1997)
   PUBMED   9299475
REFERENCE   2  (bases 1 to 389)
  AUTHORS   Holmes,D.I., Abdel Wahab,N. and Mason,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-1998) Division of Biomedical Sciences, Imperial
            College School of Medicine at Charing Cross Hospital, Fulham Palace
            Road, London W6 8RF, United Kingdom
FEATURES             Location/Qualifiers
     source          1..389
                     /db_xref="H-InvDB:HIT000066562"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="mesangial"
                     /dev_stage="adult"
     CDS             <1..>389
                     /note="regulated by glucose"
                     /codon_start=2
                     /product="putative zinc finger protein"
                     /protein_id="AAC72200.1"
                     /translation="EPILITDLGLIQPIPKNQFFQSYFNNNFVNEADRPYKCFYCHRA
                     YKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFT
                     TGGSLRRHMGIHNDLRPYMCPYCQKKK"
     primer_bind     1..10
                     /note="arbitrary primer; used to amplify differential
                     display fragment from cells exposed to elevated glucose"
     primer_bind     complement(376..389)
                     /note="anchored primer; (T)12MG, where M is threefold
                     degenerate for G, A and C; used to amplify differential
                     display fragment from cells exposed to elevated glucose"
BASE COUNT          127 a           91 c           66 g          105 t
ORIGIN      
        1 ggaaccaatc ctcataactg acttaggtct catccagccc attccaaaaa accagttttt
       61 ccaaagctat ttcaataata attttgtcaa tgaagcagat agaccataca agtgttttta
      121 ctgtcatcgt gcatataaaa aatcttgcca ccttaaacaa cacatcagat cccatacagg
      181 tgaaaaacct tttaaatgtt ctcagtgtgg aagaggcttt gtttctgcag gcgtgctcaa
      241 agcacacatc agaacacaca caggactgaa atctttcaag tgtctgatat gtaatggggc
      301 tttcactact ggtggcagct tacggcgaca catgggtatc cacaacgacc ttcgtcccta
      361 tatgtgtccc tattgccaaa aaaaaaaaa
//