LOCUS AF083213 389 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens putative zinc finger protein mRNA, partial cds. ACCESSION AF083213 VERSION AF083213.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 389) AUTHORS Holmes,D.I., Abdel Wahab,N. and Mason,R.M. TITLE Identification of glucose-regulated genes in human mesangial cells by mRNA differential display JOURNAL Biochem. Biophys. Res. Commun. 238 (1), 179-184 (1997) PUBMED 9299475 REFERENCE 2 (bases 1 to 389) AUTHORS Holmes,D.I., Abdel Wahab,N. and Mason,R.M. TITLE Direct Submission JOURNAL Submitted (10-AUG-1998) Division of Biomedical Sciences, Imperial College School of Medicine at Charing Cross Hospital, Fulham Palace Road, London W6 8RF, United Kingdom FEATURES Location/Qualifiers source 1..389 /db_xref="H-InvDB:HIT000066562" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_type="mesangial" /dev_stage="adult" CDS <1..>389 /note="regulated by glucose" /codon_start=2 /product="putative zinc finger protein" /protein_id="AAC72200.1" /translation="EPILITDLGLIQPIPKNQFFQSYFNNNFVNEADRPYKCFYCHRA YKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNGAFT TGGSLRRHMGIHNDLRPYMCPYCQKKK" primer_bind 1..10 /note="arbitrary primer; used to amplify differential display fragment from cells exposed to elevated glucose" primer_bind complement(376..389) /note="anchored primer; (T)12MG, where M is threefold degenerate for G, A and C; used to amplify differential display fragment from cells exposed to elevated glucose" BASE COUNT 127 a 91 c 66 g 105 t ORIGIN 1 ggaaccaatc ctcataactg acttaggtct catccagccc attccaaaaa accagttttt 61 ccaaagctat ttcaataata attttgtcaa tgaagcagat agaccataca agtgttttta 121 ctgtcatcgt gcatataaaa aatcttgcca ccttaaacaa cacatcagat cccatacagg 181 tgaaaaacct tttaaatgtt ctcagtgtgg aagaggcttt gtttctgcag gcgtgctcaa 241 agcacacatc agaacacaca caggactgaa atctttcaag tgtctgatat gtaatggggc 301 tttcactact ggtggcagct tacggcgaca catgggtatc cacaacgacc ttcgtcccta 361 tatgtgtccc tattgccaaa aaaaaaaaa //