LOCUS AF026200 207 bp mRNA linear HUM 24-JUL-2016 DEFINITION Homo sapiens Bach1 protein homolog mRNA, partial cds. ACCESSION AF026200 VERSION AF026200.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 207) AUTHORS Blouin,J.L., Duriaux Sail,G., Guipponi,M., Rossier,C., Pappasavas,M.P. and Antonarakis,S.E. TITLE Isolation of the human BACH1 transcription regulator gene, which maps to chromosome 21q22.1 JOURNAL Hum. Genet. 102 (3), 282-288 (1998) PUBMED 9544839 REFERENCE 2 (bases 1 to 207) AUTHORS Blouin,J.-L. and Antonarakis,S.E. TITLE Direct Submission JOURNAL Submitted (22-SEP-1997) Medical Genetics, University of Geneva-School of Medicine, Centre Medical Universitaire, Rue Michel Servet 1, Geneva CH-1211, Switzerland FEATURES Location/Qualifiers source 1..207 /db_xref="H-InvDB:HIT000062804" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="21" /map="21q22.1" /clone="jla60g5" /note="exon trapping was utilized in the isolation of this sequence" CDS <1..>207 /note="similar to Mus musculus Bach1 protein encoded by the sequence presented in GenBank Accession Number D86603" /codon_start=1 /product="Bach1 protein homolog" /protein_id="AAB84101.1" /translation="VKLPFNAQRIISLSRNDFQSLLKMHKLTPEQLDCIHDIRRRSKN RIAAQRCRKRKLDCIQNLESEIEKL" BASE COUNT 74 a 39 c 41 g 53 t ORIGIN 1 gtaaaactgc cattcaatgc acaacggata atttcactgt ctcgaaatga ttttcagtcc 61 ttgttgaaaa tgcacaagct tactccagaa cagctggatt gtatccatga tattcgaaga 121 agaagtaaaa acagaattgc tgcacagcgc tgtcgcaaga gaaaacttga ctgtatacag 181 aatcttgaat cagaaattga gaagctg //