LOCUS       AF026200                 207 bp    mRNA    linear   HUM 24-JUL-2016
DEFINITION  Homo sapiens Bach1 protein homolog mRNA, partial cds.
ACCESSION   AF026200
VERSION     AF026200.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 207)
  AUTHORS   Blouin,J.L., Duriaux Sail,G., Guipponi,M., Rossier,C.,
            Pappasavas,M.P. and Antonarakis,S.E.
  TITLE     Isolation of the human BACH1 transcription regulator gene, which
            maps to chromosome 21q22.1
  JOURNAL   Hum. Genet. 102 (3), 282-288 (1998)
   PUBMED   9544839
REFERENCE   2  (bases 1 to 207)
  AUTHORS   Blouin,J.-L. and Antonarakis,S.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-SEP-1997) Medical Genetics, University of
            Geneva-School of Medicine, Centre Medical Universitaire, Rue Michel
            Servet 1, Geneva CH-1211, Switzerland
FEATURES             Location/Qualifiers
     source          1..207
                     /db_xref="H-InvDB:HIT000062804"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="21"
                     /map="21q22.1"
                     /clone="jla60g5"
                     /note="exon trapping was utilized in the isolation of this
                     sequence"
     CDS             <1..>207
                     /note="similar to Mus musculus Bach1 protein encoded by
                     the sequence presented in GenBank Accession Number D86603"
                     /codon_start=1
                     /product="Bach1 protein homolog"
                     /protein_id="AAB84101.1"
                     /translation="VKLPFNAQRIISLSRNDFQSLLKMHKLTPEQLDCIHDIRRRSKN
                     RIAAQRCRKRKLDCIQNLESEIEKL"
BASE COUNT           74 a           39 c           41 g           53 t
ORIGIN      
        1 gtaaaactgc cattcaatgc acaacggata atttcactgt ctcgaaatga ttttcagtcc
       61 ttgttgaaaa tgcacaagct tactccagaa cagctggatt gtatccatga tattcgaaga
      121 agaagtaaaa acagaattgc tgcacagcgc tgtcgcaaga gaaaacttga ctgtatacag
      181 aatcttgaat cagaaattga gaagctg
//