LOCUS AF025440 560 bp mRNA linear HUM 24-JUL-2016 DEFINITION Homo sapiens Opa-interacting protein OIP4 mRNA, partial cds. ACCESSION AF025440 VERSION AF025440.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 560) AUTHORS Williams,J.M., Chen,G.C., Zhu,L. and Rest,R.F. TITLE Using the yeast two-hybrid system to identify human epithelial cell proteins that bind gonococcal Opa proteins: intracellular gonococci bind pyruvate kinase via their Opa proteins and require host pyruvate for growth JOURNAL Mol. Microbiol. 27 (1), 171-186 (1998) PUBMED 9466265 REFERENCE 2 (bases 1 to 560) AUTHORS Williams,J.M., Zhu,L. and Rest,R.F. TITLE Direct Submission JOURNAL Submitted (17-SEP-1997) Microbiology & Immunology, Allegheny Univ of the Health Sciences, 2900 Queen Lane, Philadelphia, PA 19129, USA FEATURES Location/Qualifiers source 1..560 /db_xref="H-InvDB:HIT000062770" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="HeLa S3" /clone_lib="Clontech Matchmaker, catalog no. HL4000AA" CDS <1..177 /note="similar to PRAME; binds OpaP outer membrane protein of Neisseria gonorrhoeae strain F62SF" /codon_start=1 /product="Opa-interacting protein OIP4" /protein_id="AAC39560.1" /translation="DGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTF YDPEPILCPCFMPN" polyA_site 542 BASE COUNT 174 a 102 c 148 g 136 t ORIGIN 1 gatggtaccc tccacctgga gaggcttgcc tatctgcatg ccaggctcag ggagttgctg 61 tgtgagttgg ggcggcccag catggtctgg cttagtgcca acccctgtcc tcactgtggg 121 gacagaacct tctatgaccc ggagcccatc ctgtgcccct gtttcatgcc taactagctg 181 ggtgcacata tcaaatgctt cattctgcat acttggacac taaagccagg atgtgcatgc 241 atcttgaagc aacaaagcag ccacagtttc agacaaatgt tcagtgtgag tgaggaaaac 301 atgttcagtg aggaaaaaac attcagacaa atgttcagtg aggaaaaaaa ggggaagttg 361 gggataggca gatgttgact tgaggagtta atgtgatctt tggggagata catcttatag 421 agttagaaat agaatctgaa tttctaaagg gagattctgg cttgggaagt acatgtagga 481 gttaatccct gtgtagactg ttgtaaagaa actgttgaaa ataaagagaa gcaatgtgaa 541 gcaaaaaaaa aaaaaaaaaa //