LOCUS       AF025440                 560 bp    mRNA    linear   HUM 24-JUL-2016
DEFINITION  Homo sapiens Opa-interacting protein OIP4 mRNA, partial cds.
ACCESSION   AF025440
VERSION     AF025440.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 560)
  AUTHORS   Williams,J.M., Chen,G.C., Zhu,L. and Rest,R.F.
  TITLE     Using the yeast two-hybrid system to identify human epithelial cell
            proteins that bind gonococcal Opa proteins: intracellular gonococci
            bind pyruvate kinase via their Opa proteins and require host
            pyruvate for growth
  JOURNAL   Mol. Microbiol. 27 (1), 171-186 (1998)
   PUBMED   9466265
REFERENCE   2  (bases 1 to 560)
  AUTHORS   Williams,J.M., Zhu,L. and Rest,R.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-SEP-1997) Microbiology & Immunology, Allegheny Univ
            of the Health Sciences, 2900 Queen Lane, Philadelphia, PA 19129,
            USA
FEATURES             Location/Qualifiers
     source          1..560
                     /db_xref="H-InvDB:HIT000062770"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HeLa S3"
                     /clone_lib="Clontech Matchmaker, catalog no. HL4000AA"
     CDS             <1..177
                     /note="similar to PRAME; binds OpaP outer membrane protein
                     of Neisseria gonorrhoeae strain F62SF"
                     /codon_start=1
                     /product="Opa-interacting protein OIP4"
                     /protein_id="AAC39560.1"
                     /translation="DGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTF
                     YDPEPILCPCFMPN"
     polyA_site      542
BASE COUNT          174 a          102 c          148 g          136 t
ORIGIN      
        1 gatggtaccc tccacctgga gaggcttgcc tatctgcatg ccaggctcag ggagttgctg
       61 tgtgagttgg ggcggcccag catggtctgg cttagtgcca acccctgtcc tcactgtggg
      121 gacagaacct tctatgaccc ggagcccatc ctgtgcccct gtttcatgcc taactagctg
      181 ggtgcacata tcaaatgctt cattctgcat acttggacac taaagccagg atgtgcatgc
      241 atcttgaagc aacaaagcag ccacagtttc agacaaatgt tcagtgtgag tgaggaaaac
      301 atgttcagtg aggaaaaaac attcagacaa atgttcagtg aggaaaaaaa ggggaagttg
      361 gggataggca gatgttgact tgaggagtta atgtgatctt tggggagata catcttatag
      421 agttagaaat agaatctgaa tttctaaagg gagattctgg cttgggaagt acatgtagga
      481 gttaatccct gtgtagactg ttgtaaagaa actgttgaaa ataaagagaa gcaatgtgaa
      541 gcaaaaaaaa aaaaaaaaaa
//