LOCUS AF016371 747 bp mRNA linear HUM 23-DEC-2016 DEFINITION Homo sapiens U-snRNP-associated cyclophilin (USA-CyP) mRNA, complete cds. ACCESSION AF016371 VERSION AF016371.2 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 747) AUTHORS Horowitz,D.S., Kobayashi,R. and Krainer,A.R. TITLE A new cyclophilin and the human homologues of yeast Prp3 and Prp4 form a complex associated with U4/U6 snRNPs JOURNAL RNA 3 (12), 1374-1387 (1997) PUBMED 9404889 REFERENCE 2 (bases 1 to 747) AUTHORS Horowitz,D.S., Kobayashi,R. and Krainer,A.R. TITLE Direct Submission JOURNAL Submitted (29-JUL-1997) Biochemistry and Molecular Biology, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814, USA REFERENCE 3 (bases 1 to 747) AUTHORS Horowitz,D.S., Kobayashi,R. and Krainer,A.R. TITLE Direct Submission JOURNAL Submitted (23-DEC-2016) Biochemistry and Molecular Biology, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814, USA REMARK Sequence update by database staff to remove vector contamination COMMENT On Dec 23, 2016 this sequence version replaced AF016371.1. FEATURES Location/Qualifiers source 1..747 /db_xref="H-InvDB:HIT000062392" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /tissue_type="liver" gene 1..747 /gene="USA-CyP" CDS 13..546 /gene="USA-CyP" /note="similar to Caenorhabditis elegans cyclophilin isoform 11 encoded by the sequence presented in the file with GenBank Accession Number U34955" /codon_start=1 /product="U-snRNP-associated cyclophilin" /protein_id="AAC51927.1" /translation="MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFR QFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKL RHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTG PNNKPKLPVVISQCGEM" BASE COUNT 191 a 152 c 199 g 205 t ORIGIN 1 cgggtcggag ccatggcggt ggcaaattca agtcctgtta accccgtggt gttctttgat 61 gtcagtattg gcggtcagga agttggccgc atgaagatcg agctctttgc agacgttgtg 121 cctaagacgg ccgagaactt taggcagttc tgcaccggag aattcaggaa agatggggtt 181 ccaataggat acaaaggaag caccttccac agggtcataa aggatttcat gattcagggt 241 ggagattttg ttaatggaga tggtactgga gtcgccagta tttaccgggg gccatttgca 301 gatgaaaatt ttaaacttag acactcagct ccaggcctgc tttccatggc gaacagtggt 361 ccaagtacaa atggctgtca gttctttatc acctgctcta agtgcgattg gctggatggg 421 aagcatgtgg tgtttggaaa aatcatcgat ggacttctag tgatgagaaa gattgagaat 481 gttcccacag gccccaacaa taagcccaag ctacctgtgg tgatctcgca gtgtggggag 541 atgtagtcca gacaaagact gaatcaggcc ttcccttctt cttggtggtg ttcttgagta 601 agataatctg gactggcccc cgtctttgct tccctgcctg ctgctgcccc atttgatcaa 661 gagaccatgg aagtgtcaga gattcagaat ccaagattgt ctttaagttt tcaactgtaa 721 ataaagtttt tttgtatgcg taaaaaa //