LOCUS       AF016371                 747 bp    mRNA    linear   HUM 23-DEC-2016
DEFINITION  Homo sapiens U-snRNP-associated cyclophilin (USA-CyP) mRNA,
            complete cds.
ACCESSION   AF016371
VERSION     AF016371.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 747)
  AUTHORS   Horowitz,D.S., Kobayashi,R. and Krainer,A.R.
  TITLE     A new cyclophilin and the human homologues of yeast Prp3 and Prp4
            form a complex associated with U4/U6 snRNPs
  JOURNAL   RNA 3 (12), 1374-1387 (1997)
   PUBMED   9404889
REFERENCE   2  (bases 1 to 747)
  AUTHORS   Horowitz,D.S., Kobayashi,R. and Krainer,A.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-1997) Biochemistry and Molecular Biology,
            Uniformed Services University of the Health Sciences, 4301 Jones
            Bridge Road, Bethesda, MD 20814, USA
REFERENCE   3  (bases 1 to 747)
  AUTHORS   Horowitz,D.S., Kobayashi,R. and Krainer,A.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-DEC-2016) Biochemistry and Molecular Biology,
            Uniformed Services University of the Health Sciences, 4301 Jones
            Bridge Road, Bethesda, MD 20814, USA
  REMARK    Sequence update by database staff to remove vector contamination
COMMENT     On Dec 23, 2016 this sequence version replaced AF016371.1.
FEATURES             Location/Qualifiers
     source          1..747
                     /db_xref="H-InvDB:HIT000062392"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="liver"
     gene            1..747
                     /gene="USA-CyP"
     CDS             13..546
                     /gene="USA-CyP"
                     /note="similar to Caenorhabditis elegans cyclophilin
                     isoform 11 encoded by the sequence presented in the file
                     with GenBank Accession Number U34955"
                     /codon_start=1
                     /product="U-snRNP-associated cyclophilin"
                     /protein_id="AAC51927.1"
                     /translation="MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFR
                     QFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKL
                     RHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTG
                     PNNKPKLPVVISQCGEM"
BASE COUNT          191 a          152 c          199 g          205 t
ORIGIN      
        1 cgggtcggag ccatggcggt ggcaaattca agtcctgtta accccgtggt gttctttgat
       61 gtcagtattg gcggtcagga agttggccgc atgaagatcg agctctttgc agacgttgtg
      121 cctaagacgg ccgagaactt taggcagttc tgcaccggag aattcaggaa agatggggtt
      181 ccaataggat acaaaggaag caccttccac agggtcataa aggatttcat gattcagggt
      241 ggagattttg ttaatggaga tggtactgga gtcgccagta tttaccgggg gccatttgca
      301 gatgaaaatt ttaaacttag acactcagct ccaggcctgc tttccatggc gaacagtggt
      361 ccaagtacaa atggctgtca gttctttatc acctgctcta agtgcgattg gctggatggg
      421 aagcatgtgg tgtttggaaa aatcatcgat ggacttctag tgatgagaaa gattgagaat
      481 gttcccacag gccccaacaa taagcccaag ctacctgtgg tgatctcgca gtgtggggag
      541 atgtagtcca gacaaagact gaatcaggcc ttcccttctt cttggtggtg ttcttgagta
      601 agataatctg gactggcccc cgtctttgct tccctgcctg ctgctgcccc atttgatcaa
      661 gagaccatgg aagtgtcaga gattcagaat ccaagattgt ctttaagttt tcaactgtaa
      721 ataaagtttt tttgtatgcg taaaaaa
//