LOCUS       AF016028                 732 bp    mRNA    linear   HUM 24-APR-2000
DEFINITION  Homo sapiens sarcospan-2 (SSPN2) mRNA, complete cds.
ACCESSION   AF016028
VERSION     AF016028.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 732)
  AUTHORS   Crosbie,R.H., Heighway,J., Venzke,D.P., Lee,J.C. and Campbell,K.P.
  TITLE     Sarcospan, the 25-kDa transmembrane component of the
            dystrophin-glycoprotein complex
  JOURNAL   J. Biol. Chem. 272 (50), 31221-31224 (1997)
   PUBMED   9395445
REFERENCE   2  (bases 1 to 732)
  AUTHORS   Heighway,J., Betticher,D.C., Hoban,P.R., Altermatt,H.J. and
            Cowen,R.
  TITLE     Coamplification in tumors of KRAS2, type 2 inositol 1,4,5
            triphosphase receptor gene, and a novel human gene, KRAG
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 732)
  AUTHORS   Crosbie,R.H., Heighway,J., Venzke,D.P. and Campbell,K.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUL-1997) Physiology & Biophysics, University of
            Iowa, 400 Eckstein Medical Research Building, Iowa City, IA 52242,
            USA
REFERENCE   4  (bases 1 to 732)
  AUTHORS   Crosbie,R.H., Heighway,J., Venzke,D.P. and Campbell,K.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-APR-2000) Physiology & Biophysics, University of
            Iowa, 400 Eckstein Medical Research Building, Iowa City, IA 52242,
            USA
  REMARK    Sequence update by submitter
COMMENT     On Apr 24, 2000 this sequence version replaced AF016028.1.
FEATURES             Location/Qualifiers
     source          1..732
                     /db_xref="H-InvDB:HIT000062378"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12p11.2"
                     /tissue_type="skeletal muscle"
     gene            1..732
                     /gene="SSPN2"
     CDS             1..732
                     /gene="SSPN2"
                     /note="component of the dystrophin-glycoprotein complex;
                     predicted to have four transmembrane spanning domains,
                     similar to the tetraspans"
                     /codon_start=1
                     /product="sarcospan-2"
                     /protein_id="AAC61660.2"
                     /translation="MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEP
                     RTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGL
                     FMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLD
                     SCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWK
                     HRYQVFYVGVRICSLTASEGPQQKI"
BASE COUNT          128 a          212 c          214 g          178 t
ORIGIN      
        1 atgggcaaga acaagcagcc acgcggccag cagaggcagg ggggcccgcc ggccgcggac
       61 gccgctgggc ccgacgacat ggagccgaag aagggcacgg gggcccccaa ggagtgcggg
      121 gaggaggagc cccggacctg ctgcggctgc cggttcccgc tgctgctcgc cctgctgcag
      181 ctggccctgg gcatcgccgt gaccgtggtg ggcttcctca tggcgagcat cagctcctcc
      241 ctgctagtca gggacactcc attttgggct gggatcattg tctgcttagt ggcctatctt
      301 ggcttgttta tgctttgtgt ctcatatcag gttgacgaac ggacatgtat tcaattttct
      361 atgaaactgt tatactttct gctgagtgcc ctgggcctga cggtctgtgt gctggccgtg
      421 gcctttgccg cccaccacta ttcgcagctc acacagttta cctgtgagac cacactcgac
      481 tcttgccagt gcaaactgcc ctcctcggag ccgctcagca ggacctttgt ttaccgggat
      541 gtgacggact gtaccagcgt cactggcact ttcaaactgt tcttactcat ccagatgatt
      601 cttaatttgg tctgcggcct tgtgtgcttg ttggcctgct ttgtgatgtg gaaacatagg
      661 taccaggtct tctatgtggg tgtcaggata tgctccctca cggcttccga aggcccccag
      721 caaaagatct aa
//