LOCUS AF016028 732 bp mRNA linear HUM 24-APR-2000 DEFINITION Homo sapiens sarcospan-2 (SSPN2) mRNA, complete cds. ACCESSION AF016028 VERSION AF016028.2 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 732) AUTHORS Crosbie,R.H., Heighway,J., Venzke,D.P., Lee,J.C. and Campbell,K.P. TITLE Sarcospan, the 25-kDa transmembrane component of the dystrophin-glycoprotein complex JOURNAL J. Biol. Chem. 272 (50), 31221-31224 (1997) PUBMED 9395445 REFERENCE 2 (bases 1 to 732) AUTHORS Heighway,J., Betticher,D.C., Hoban,P.R., Altermatt,H.J. and Cowen,R. TITLE Coamplification in tumors of KRAS2, type 2 inositol 1,4,5 triphosphase receptor gene, and a novel human gene, KRAG JOURNAL Unpublished REFERENCE 3 (bases 1 to 732) AUTHORS Crosbie,R.H., Heighway,J., Venzke,D.P. and Campbell,K.P. TITLE Direct Submission JOURNAL Submitted (24-JUL-1997) Physiology & Biophysics, University of Iowa, 400 Eckstein Medical Research Building, Iowa City, IA 52242, USA REFERENCE 4 (bases 1 to 732) AUTHORS Crosbie,R.H., Heighway,J., Venzke,D.P. and Campbell,K.P. TITLE Direct Submission JOURNAL Submitted (24-APR-2000) Physiology & Biophysics, University of Iowa, 400 Eckstein Medical Research Building, Iowa City, IA 52242, USA REMARK Sequence update by submitter COMMENT On Apr 24, 2000 this sequence version replaced AF016028.1. FEATURES Location/Qualifiers source 1..732 /db_xref="H-InvDB:HIT000062378" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="12" /map="12p11.2" /tissue_type="skeletal muscle" gene 1..732 /gene="SSPN2" CDS 1..732 /gene="SSPN2" /note="component of the dystrophin-glycoprotein complex; predicted to have four transmembrane spanning domains, similar to the tetraspans" /codon_start=1 /product="sarcospan-2" /protein_id="AAC61660.2" /translation="MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEP RTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGL FMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLD SCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWK HRYQVFYVGVRICSLTASEGPQQKI" BASE COUNT 128 a 212 c 214 g 178 t ORIGIN 1 atgggcaaga acaagcagcc acgcggccag cagaggcagg ggggcccgcc ggccgcggac 61 gccgctgggc ccgacgacat ggagccgaag aagggcacgg gggcccccaa ggagtgcggg 121 gaggaggagc cccggacctg ctgcggctgc cggttcccgc tgctgctcgc cctgctgcag 181 ctggccctgg gcatcgccgt gaccgtggtg ggcttcctca tggcgagcat cagctcctcc 241 ctgctagtca gggacactcc attttgggct gggatcattg tctgcttagt ggcctatctt 301 ggcttgttta tgctttgtgt ctcatatcag gttgacgaac ggacatgtat tcaattttct 361 atgaaactgt tatactttct gctgagtgcc ctgggcctga cggtctgtgt gctggccgtg 421 gcctttgccg cccaccacta ttcgcagctc acacagttta cctgtgagac cacactcgac 481 tcttgccagt gcaaactgcc ctcctcggag ccgctcagca ggacctttgt ttaccgggat 541 gtgacggact gtaccagcgt cactggcact ttcaaactgt tcttactcat ccagatgatt 601 cttaatttgg tctgcggcct tgtgtgcttg ttggcctgct ttgtgatgtg gaaacatagg 661 taccaggtct tctatgtggg tgtcaggata tgctccctca cggcttccga aggcccccag 721 caaaagatct aa //