LOCUS       AF006087                 820 bp    mRNA    linear   HUM 15-DEC-1999
DEFINITION  Homo sapiens Arp2/3 protein complex subunit p20-Arc (ARC20) mRNA,
            complete cds.
ACCESSION   AF006087
VERSION     AF006087.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 820)
  AUTHORS   Welch,M.D., DePace,A.H., Verma,S., Iwamatsu,A. and Mitchison,T.J.
  TITLE     The human Arp2/3 complex is composed of evolutionarily conserved
            subunits and is localized to cellular regions of dynamic actin
            filament assembly
  JOURNAL   J. Cell Biol. 138 (2), 375-384 (1997)
   PUBMED   9230079
REFERENCE   2  (bases 1 to 820)
  AUTHORS   Welch,M.D., DePace,A.H., Verma,S., Iwamatsu,A. and Mitchison,T.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-1997) Cellular and Molecular Pharmacology,
            University of California, San Francisco, 513 Parnassus Ave., San
            Francisco, CA 94143-0450, USA
FEATURES             Location/Qualifiers
     source          1..820
                     /db_xref="H-InvDB:HIT000061822"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /note="EST clone Id number 187446"
     gene            1..820
                     /gene="ARC20"
     CDS             16..522
                     /gene="ARC20"
                     /note="20 kD subunit of the Arp2/3 protein complex"
                     /codon_start=1
                     /product="p20-Arc"
                     /protein_id="AAB64192.1"
                     /translation="MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSK
                     ELLLQPVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFF
                     ILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIV
                     AEEFLKNF"
BASE COUNT          201 a          201 c          231 g          187 t
ORIGIN      
        1 cagccagcgc ccgcgatgac tgccactctc cgcccctacc tgagtgccgt gcgggccaca
       61 ttgcaggctg ccctctgcct ggagaacttc tcctcccagg ttgtggaacg acacaacaag
      121 ccggaagtgg aagtcaggag tagcaaagag ctcctgttac aacctgtgac catcagcagg
      181 aatgagaagg aaaaggttct gattgagggc tccatcaact ctgtccgggt cagcattgct
      241 gtgaaacagg ctgatgagat cgagaagatt ttgtgccaca agttcatgcg cttcatgatg
      301 atgcgagcag agaacttctt tatccttcga aggaagcctg tggaggggta tgatatcagc
      361 tttctgatca ccaacttcca cacagagcag atgtacaaac acaagttggt ggactttgtg
      421 atccacttca tggaggagat tgacaaggag atcagtgaga tgaagctgtc agtcaatgcc
      481 cgtgcccgca ttgtggctga agagttcctt aagaattttt aaaccatctg gctggatctc
      541 gtggccttcc ccctcagact acccatgtct ccacgaaggc gtcctggagt cactccccga
      601 gcagcgcggc ggcggcaggg agttgggttg gggtgggcat ttgatgcggg aggtgggtgg
      661 tgtgcttgct agctgggcaa gaaagcagca gtggacctgc cccaaggcca cacgtgcctg
      721 gtcaggctgg cttctgatgt tcagtcccct gggccgggac agattttttt taacgtcttg
      781 aaacttaaac tctgtgcttg taaaaaaaaa aaaaaaaaaa
//