LOCUS AF006087 820 bp mRNA linear HUM 15-DEC-1999 DEFINITION Homo sapiens Arp2/3 protein complex subunit p20-Arc (ARC20) mRNA, complete cds. ACCESSION AF006087 VERSION AF006087.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 820) AUTHORS Welch,M.D., DePace,A.H., Verma,S., Iwamatsu,A. and Mitchison,T.J. TITLE The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly JOURNAL J. Cell Biol. 138 (2), 375-384 (1997) PUBMED 9230079 REFERENCE 2 (bases 1 to 820) AUTHORS Welch,M.D., DePace,A.H., Verma,S., Iwamatsu,A. and Mitchison,T.J. TITLE Direct Submission JOURNAL Submitted (02-JUN-1997) Cellular and Molecular Pharmacology, University of California, San Francisco, 513 Parnassus Ave., San Francisco, CA 94143-0450, USA FEATURES Location/Qualifiers source 1..820 /db_xref="H-InvDB:HIT000061822" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /note="EST clone Id number 187446" gene 1..820 /gene="ARC20" CDS 16..522 /gene="ARC20" /note="20 kD subunit of the Arp2/3 protein complex" /codon_start=1 /product="p20-Arc" /protein_id="AAB64192.1" /translation="MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSK ELLLQPVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFF ILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIV AEEFLKNF" BASE COUNT 201 a 201 c 231 g 187 t ORIGIN 1 cagccagcgc ccgcgatgac tgccactctc cgcccctacc tgagtgccgt gcgggccaca 61 ttgcaggctg ccctctgcct ggagaacttc tcctcccagg ttgtggaacg acacaacaag 121 ccggaagtgg aagtcaggag tagcaaagag ctcctgttac aacctgtgac catcagcagg 181 aatgagaagg aaaaggttct gattgagggc tccatcaact ctgtccgggt cagcattgct 241 gtgaaacagg ctgatgagat cgagaagatt ttgtgccaca agttcatgcg cttcatgatg 301 atgcgagcag agaacttctt tatccttcga aggaagcctg tggaggggta tgatatcagc 361 tttctgatca ccaacttcca cacagagcag atgtacaaac acaagttggt ggactttgtg 421 atccacttca tggaggagat tgacaaggag atcagtgaga tgaagctgtc agtcaatgcc 481 cgtgcccgca ttgtggctga agagttcctt aagaattttt aaaccatctg gctggatctc 541 gtggccttcc ccctcagact acccatgtct ccacgaaggc gtcctggagt cactccccga 601 gcagcgcggc ggcggcaggg agttgggttg gggtgggcat ttgatgcggg aggtgggtgg 661 tgtgcttgct agctgggcaa gaaagcagca gtggacctgc cccaaggcca cacgtgcctg 721 gtcaggctgg cttctgatgt tcagtcccct gggccgggac agattttttt taacgtcttg 781 aaacttaaac tctgtgcttg taaaaaaaaa aaaaaaaaaa //