LOCUS AF004900 1524 bp mRNA linear HUM 07-OCT-1998 DEFINITION Homo sapiens NHE3 kinase A regulatory protein E3KARP mRNA, complete cds. ACCESSION AF004900 VERSION AF004900.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1524) AUTHORS Yun,C.H., Oh,S., Zizak,M., Steplock,D., Tsao,S., Tse,C.M., Weinman,E.J. and Donowitz,M. TITLE cAMP-mediated inhibition of the epithelial brush border Na+/H+ exchanger, NHE3, requires an associated regulatory protein JOURNAL Proc. Natl. Acad. Sci. U.S.A. 94 (7), 3010-3015 (1997) PUBMED 9096337 REFERENCE 2 (bases 1 to 1524) AUTHORS Yun,C.H., Lamprecht,G., Forster,D.V. and Sidor,A. TITLE NHE3 kinase A regulatory protein E3KARP binds the epithelial brush border Na+/H+ exchanger NHE3 and the cytoskeletal protein ezrin JOURNAL J. Biol. Chem. 273 (40), 25856-25863 (1998) PUBMED 9748260 REFERENCE 3 (bases 1 to 1524) AUTHORS Yun,C.H. TITLE Direct Submission JOURNAL Submitted (20-MAY-1997) Medicine, Johns Hopkins School of Medicine, GI Unit, 918 Ross Building, 720 Rutland Avenue, Baltimore, MD 21205, USA FEATURES Location/Qualifiers source 1..1524 /db_xref="H-InvDB:HIT000061769" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 17..1030 /note="NHE3 associated regulatory protein; NHE3 kinase A regulatory protein" /codon_start=1 /product="E3KARP" /protein_id="AAC63061.1" /translation="MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSP AEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLT CTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQG YGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA REDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSD LPGSDKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIF SNF" BASE COUNT 305 a 498 c 495 g 226 t ORIGIN 1 gtgggcagcg ggcgccatgg ccgcgccgga gccgctgcgg ccgcgcctgt gccgcttggt 61 gcgcggagag cagggctacg gcttccacct gcacggcgag aagggccgcc gcgggcagtt 121 catccggcgc gtggaacccg gttcccccgc cgaggccgcc gcgctgcgcg ctggggaccg 181 cctggtcgag gtcaacggcg tcaacgtgga gggcgagacg caccaccagg tggtgcaaag 241 gatcaaggct gtggaggggc agactcggct gctggtggtg gaccaggaga cagatgagga 301 gctccgccgg cggcagctga cctgtaccga ggagatggcc cagcgagggc tcccacccgc 361 ccacgacccc tgggagccga agccagactg ggcacacacc ggcagccaca gctccgaagc 421 tggcaagaag gatgtcagtg ggcccctgag ggagctgcgc cctcggctct gccacctgcg 481 aaagggacct cagggctatg ggttcaacct gcatagtgac aagtcccggc ccggccagta 541 catccgctct gtggacccgg gctcacctgc cgcccgctct ggcctccgcg cccaggaccg 601 gctcattgag gtgaacgggc agaatgtgga gggactgcgc catgctgagg tggtggccag 661 catcaaggca cgggaggacg aggcccggct gctggtcgtg gaccccgaga cagatgaaca 721 cttcaagcgg cttcgggtca cacccaccga ggagcacgtg gaaggtcctc tgccgtcacc 781 cgtcaccaat ggaaccagcc ctgcccagct caatggtggc tctgcgtgct catcccgaag 841 tgacctgcct ggttccgaca aggacactga ggatggcagt gcctggaagc aagatccctt 901 ccaggagagc ggcctccacc tgagccccac ggcggccgag gccaaggaga aggctcgagc 961 catgcgagtc aacaagcgcg cgccacagat ggactggaac aggaagcgtg aaatcttcag 1021 caacttctga gccccttcct gcctgtctcg ggaccctggg acccctcccg cacggacctt 1081 gggcctcagc ctgccccgag ctcccccagc ctcagtggac tggagggtgg tcctgccatt 1141 gcccagaaat cagccccagc cccggtgagc ccccatcctg cccctgccca ccaggtactg 1201 ggggcctgtg gcagcaagat agggggagag agacccagag atgtgagaga gagtcagaga 1261 cagagacaga gagagagaga gagagacaca gagagagaca gagagagagc gagcgagcgc 1321 gcggcagccg cggggcgagg gcctttgctg ctctgccggg gcctgctgac tgaaaggaat 1381 ttgtgttttt gctttttttc caaaaagatc tccagctcca cacatgtttc cacttaatac 1441 cagagacccc ccccttcccc tcccccttcc cctccccctt gggacgcgct ctaaataatt 1501 gcaataaaac aaacctttct ctgc //