LOCUS       AF004900                1524 bp    mRNA    linear   HUM 07-OCT-1998
DEFINITION  Homo sapiens NHE3 kinase A regulatory protein E3KARP mRNA, complete
            cds.
ACCESSION   AF004900
VERSION     AF004900.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1524)
  AUTHORS   Yun,C.H., Oh,S., Zizak,M., Steplock,D., Tsao,S., Tse,C.M.,
            Weinman,E.J. and Donowitz,M.
  TITLE     cAMP-mediated inhibition of the epithelial brush border Na+/H+
            exchanger, NHE3, requires an associated regulatory protein
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 94 (7), 3010-3015 (1997)
   PUBMED   9096337
REFERENCE   2  (bases 1 to 1524)
  AUTHORS   Yun,C.H., Lamprecht,G., Forster,D.V. and Sidor,A.
  TITLE     NHE3 kinase A regulatory protein E3KARP binds the epithelial brush
            border Na+/H+ exchanger NHE3 and the cytoskeletal protein ezrin
  JOURNAL   J. Biol. Chem. 273 (40), 25856-25863 (1998)
   PUBMED   9748260
REFERENCE   3  (bases 1 to 1524)
  AUTHORS   Yun,C.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-1997) Medicine, Johns Hopkins School of Medicine,
            GI Unit, 918 Ross Building, 720 Rutland Avenue, Baltimore, MD
            21205, USA
FEATURES             Location/Qualifiers
     source          1..1524
                     /db_xref="H-InvDB:HIT000061769"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             17..1030
                     /note="NHE3 associated regulatory protein; NHE3 kinase A
                     regulatory protein"
                     /codon_start=1
                     /product="E3KARP"
                     /protein_id="AAC63061.1"
                     /translation="MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSP
                     AEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLT
                     CTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQG
                     YGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA
                     REDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSD
                     LPGSDKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIF
                     SNF"
BASE COUNT          305 a          498 c          495 g          226 t
ORIGIN      
        1 gtgggcagcg ggcgccatgg ccgcgccgga gccgctgcgg ccgcgcctgt gccgcttggt
       61 gcgcggagag cagggctacg gcttccacct gcacggcgag aagggccgcc gcgggcagtt
      121 catccggcgc gtggaacccg gttcccccgc cgaggccgcc gcgctgcgcg ctggggaccg
      181 cctggtcgag gtcaacggcg tcaacgtgga gggcgagacg caccaccagg tggtgcaaag
      241 gatcaaggct gtggaggggc agactcggct gctggtggtg gaccaggaga cagatgagga
      301 gctccgccgg cggcagctga cctgtaccga ggagatggcc cagcgagggc tcccacccgc
      361 ccacgacccc tgggagccga agccagactg ggcacacacc ggcagccaca gctccgaagc
      421 tggcaagaag gatgtcagtg ggcccctgag ggagctgcgc cctcggctct gccacctgcg
      481 aaagggacct cagggctatg ggttcaacct gcatagtgac aagtcccggc ccggccagta
      541 catccgctct gtggacccgg gctcacctgc cgcccgctct ggcctccgcg cccaggaccg
      601 gctcattgag gtgaacgggc agaatgtgga gggactgcgc catgctgagg tggtggccag
      661 catcaaggca cgggaggacg aggcccggct gctggtcgtg gaccccgaga cagatgaaca
      721 cttcaagcgg cttcgggtca cacccaccga ggagcacgtg gaaggtcctc tgccgtcacc
      781 cgtcaccaat ggaaccagcc ctgcccagct caatggtggc tctgcgtgct catcccgaag
      841 tgacctgcct ggttccgaca aggacactga ggatggcagt gcctggaagc aagatccctt
      901 ccaggagagc ggcctccacc tgagccccac ggcggccgag gccaaggaga aggctcgagc
      961 catgcgagtc aacaagcgcg cgccacagat ggactggaac aggaagcgtg aaatcttcag
     1021 caacttctga gccccttcct gcctgtctcg ggaccctggg acccctcccg cacggacctt
     1081 gggcctcagc ctgccccgag ctcccccagc ctcagtggac tggagggtgg tcctgccatt
     1141 gcccagaaat cagccccagc cccggtgagc ccccatcctg cccctgccca ccaggtactg
     1201 ggggcctgtg gcagcaagat agggggagag agacccagag atgtgagaga gagtcagaga
     1261 cagagacaga gagagagaga gagagacaca gagagagaca gagagagagc gagcgagcgc
     1321 gcggcagccg cggggcgagg gcctttgctg ctctgccggg gcctgctgac tgaaaggaat
     1381 ttgtgttttt gctttttttc caaaaagatc tccagctcca cacatgtttc cacttaatac
     1441 cagagacccc ccccttcccc tcccccttcc cctccccctt gggacgcgct ctaaataatt
     1501 gcaataaaac aaacctttct ctgc
//