LOCUS AB621812 596 bp mRNA linear HUM 24-AUG-2011 DEFINITION Homo sapiens SEC16A mRNA for protein transport protein Sec16A, partial cds, clone: HP07225-RBd93C08. ACCESSION AB621812 VERSION AB621812.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 596) AUTHORS Kato,S. TITLE Direct Submission JOURNAL Submitted (25-MAR-2011) to the DDBJ/EMBL/GenBank databases. Contact:Seishi Kato National Rehabilitation Center for Persons with Disabilities, Research Institute, Department of Rehabilitation Engineering; 4-1 Namiki, Tokorozawa, Saitama 359-8555, Japan URL :http://www.rehab.go.jp/ REFERENCE 2 AUTHORS Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M., Toyama,S., Usami,R., Ohtoko,K. and Kato,S. TITLE Full-Length Transcriptome Analysis of Human Retina-Derived Cell Lines ARPE-19 and Y79 Using the Vector-Capping Method JOURNAL Invest. Ophthalmol. Vis. Sci. 52, 6662-6670 (2011) COMMENT For cDNA clones and library availability, please contact RIKEN BioResource Center. E-mail: dnabank@brc.riken.jp URL:http://dna.brc.riken.jp/ FEATURES Location/Qualifiers source 1..596 /cell_line="Y79" /cell_type="retinoblastoma" /clone="HP07225-RBd93C08" /clone_lib="pGCAP10/Y79 cDNA" /db_xref="H-InvDB:HIT000660488" /db_xref="taxon:9606" /mol_type="mRNA" /note="The 5'-end sequence of the full-length cDNA clone. The 3'-end sequence has not yet been determined." /organism="Homo sapiens" CDS 171..>596 /codon_start=1 /gene="SEC16A" /product="protein transport protein Sec16A" /protein_id="BAK64148.1" /transl_table=1 /translation="MQPPPQTVPSGMAGPPPAGNPRSVFWASSPYRRRANNNAAVAPT TCPLQPVTDPFAFSRQALQSTPLGSSSKSSPPVLQGPAPAGFSQHPGLLVPHTHARDS SQGPCEPLPGPLTQPRAHASPFSGALTPSAPPGPEMNRSA" BASE COUNT 113 a 189 c 167 g 127 t ORIGIN 1 atgtgccaag atggctgcgg cggctgaggt gtctgtgctc gtcgccagcg tcgggtgggc 61 tttcgcccgc ggctcctgag ggatcggtct cagccgcgcg gctccaatta aggaacagct 121 atatcctgct tccttctgta agcagcatcg acttgtgcaa gggttcagtc atgcagccac 181 cgccccagac ggtcccgtct ggcatggctg ggccacctcc agccgggaat cctcggagcg 241 tgttctgggc tagcagccct tacaggagac gggctaataa taatgcagca gtggctccga 301 caacttgccc gttgcagccg gtcacggatc catttgcttt tagtagacag gcgctccaaa 361 gtacaccact gggcagttcg tccaaaagca gtccacctgt cttgcaaggc ccagcccccg 421 cagggttttc tcagcacccc ggtttgcttg tgcctcacac acatgccaga gatagctctc 481 agggaccctg tgagcccctg cctggacctc tgacacagcc cagagcacat gccagtccgt 541 tttctggtgc attgacacct tcagcacctc ctgggcctga gatgaacagg agtgca //