LOCUS       AB621812                 596 bp    mRNA    linear   HUM 24-AUG-2011
DEFINITION  Homo sapiens SEC16A mRNA for protein transport protein Sec16A,
            partial cds, clone: HP07225-RBd93C08.
ACCESSION   AB621812
VERSION     AB621812.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 596)
  AUTHORS   Kato,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-MAR-2011) to the DDBJ/EMBL/GenBank databases.
            Contact:Seishi Kato
            National Rehabilitation Center for Persons with Disabilities,
            Research Institute, Department of Rehabilitation Engineering; 4-1
            Namiki, Tokorozawa, Saitama 359-8555, Japan
            URL    :http://www.rehab.go.jp/
REFERENCE   2
  AUTHORS   Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M.,
            Toyama,S., Usami,R., Ohtoko,K. and Kato,S.
  TITLE     Full-Length Transcriptome Analysis of Human Retina-Derived Cell
            Lines ARPE-19 and Y79 Using the Vector-Capping Method
  JOURNAL   Invest. Ophthalmol. Vis. Sci. 52, 6662-6670 (2011)
COMMENT     For cDNA clones and library availability, please contact
            RIKEN BioResource Center.
            E-mail: dnabank@brc.riken.jp
            URL:http://dna.brc.riken.jp/
FEATURES             Location/Qualifiers
     source          1..596
                     /cell_line="Y79"
                     /cell_type="retinoblastoma"
                     /clone="HP07225-RBd93C08"
                     /clone_lib="pGCAP10/Y79 cDNA"
                     /db_xref="H-InvDB:HIT000660488"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="The 5'-end sequence of the full-length cDNA clone.
                     The 3'-end sequence has not yet been determined."
                     /organism="Homo sapiens"
     CDS             171..>596
                     /codon_start=1
                     /gene="SEC16A"
                     /product="protein transport protein Sec16A"
                     /protein_id="BAK64148.1"
                     /transl_table=1
                     /translation="MQPPPQTVPSGMAGPPPAGNPRSVFWASSPYRRRANNNAAVAPT
                     TCPLQPVTDPFAFSRQALQSTPLGSSSKSSPPVLQGPAPAGFSQHPGLLVPHTHARDS
                     SQGPCEPLPGPLTQPRAHASPFSGALTPSAPPGPEMNRSA"
BASE COUNT          113 a          189 c          167 g          127 t
ORIGIN      
        1 atgtgccaag atggctgcgg cggctgaggt gtctgtgctc gtcgccagcg tcgggtgggc
       61 tttcgcccgc ggctcctgag ggatcggtct cagccgcgcg gctccaatta aggaacagct
      121 atatcctgct tccttctgta agcagcatcg acttgtgcaa gggttcagtc atgcagccac
      181 cgccccagac ggtcccgtct ggcatggctg ggccacctcc agccgggaat cctcggagcg
      241 tgttctgggc tagcagccct tacaggagac gggctaataa taatgcagca gtggctccga
      301 caacttgccc gttgcagccg gtcacggatc catttgcttt tagtagacag gcgctccaaa
      361 gtacaccact gggcagttcg tccaaaagca gtccacctgt cttgcaaggc ccagcccccg
      421 cagggttttc tcagcacccc ggtttgcttg tgcctcacac acatgccaga gatagctctc
      481 agggaccctg tgagcccctg cctggacctc tgacacagcc cagagcacat gccagtccgt
      541 tttctggtgc attgacacct tcagcacctc ctgggcctga gatgaacagg agtgca
//