LOCUS AB593118 441 bp mRNA linear HUM 24-AUG-2011 DEFINITION Homo sapiens HP07349 mRNA for hypothetical protein HP07349, complete cds, clone: HP07349-RBd25C04. ACCESSION AB593118 VERSION AB593118.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 441) AUTHORS Kato,S. TITLE Direct Submission JOURNAL Submitted (05-OCT-2010) to the DDBJ/EMBL/GenBank databases. Contact:Seishi Kato National Rehabilitation Center for Persons with Disabilities, Research Institute, Department of Rehabilitation Engineering; 4-1 Namiki, Tokorozawa, Saitama 359-8555, Japan URL :http://www.rehab.go.jp/ REFERENCE 2 AUTHORS Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M., Toyama,S., Usami,R., Ohtoko,K. and Kato,S. TITLE Full-Length Transcriptome Analysis of Human Retina-Derived Cell Lines ARPE-19 and Y79 Using the Vector-Capping Method JOURNAL Invest. Ophthalmol. Vis. Sci. 52, 6662-6670 (2011) COMMENT For cDNA clones and library availability, please contact RIKEN BioResource Center. E-mail: dnabank@brc.riken.jp URL:http://dna.brc.riken.jp/ FEATURES Location/Qualifiers source 1..441 /cell_line="Y79" /cell_type="retinoblastoma" /clone="HP07349-RBd25C04" /clone_lib="pGCAP10/Y79 cDNA" /db_xref="H-InvDB:HIT000563919" /db_xref="taxon:9606" /mol_type="mRNA" /note="The library was prepared by Vector-capping method." /organism="Homo sapiens" CDS 85..228 /codon_start=1 /gene="HP07349" /product="hypothetical protein HP07349" /protein_id="BAJ84058.1" /transl_table=1 /translation="MPEYCPQAERRLQRGAGFQQARLTRSLAFPVLALGRPRCCFPLG ASF" BASE COUNT 65 a 126 c 156 g 94 t ORIGIN 1 gggttggaaa accaggagag catggagctt tttcgctggt ccggcgcggt ctcttgcgtt 61 cctgtggcgg gcacctgact ccccatgccc gagtactgtc ctcaggcgga acggcgtctg 121 cagcgaggag cggggttcca gcaggctcgg ctgacgcggt ccctggcatt tcccgtgctg 181 gccctgggtc gccctcgatg ctgcttcccg ctgggagcct ccttctgacg gcggaaagga 241 gcttcacctg gggcggccgg cggggaacgg agaagaatcc accggggaag tggacggggc 301 tggctcccgg gcctggcgct gcggctctcg ggccgtcaga cctcccgcgg gttgcgtcac 361 tttcctcggt tttctagaca gcagttgtgg ggttgaatcc ttgccgtggt tttgtaagaa 421 ttaaatgaga taatgaacgc g //