LOCUS       AB593091                 739 bp    mRNA    linear   HUM 24-AUG-2011
DEFINITION  Homo sapiens CRABP1 mRNA for cellular retinoic acid-binding
            protein 1, complete cds, clone: HP06370-ARh10H02.
ACCESSION   AB593091
VERSION     AB593091.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 739)
  AUTHORS   Kato,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Seishi Kato
            National Rehabilitation Center for Persons with Disabilities,
            Research Institute, Department of Rehabilitation Engineering; 4-1
            Namiki, Tokorozawa, Saitama 359-8555, Japan
            URL    :http://www.rehab.go.jp/
REFERENCE   2
  AUTHORS   Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M.,
            Toyama,S., Usami,R., Ohtoko,K. and Kato,S.
  TITLE     Full-Length Transcriptome Analysis of Human Retina-Derived Cell
            Lines ARPE-19 and Y79 Using the Vector-Capping Method
  JOURNAL   Invest. Ophthalmol. Vis. Sci. 52, 6662-6670 (2011)
COMMENT     For cDNA clones and library availability, please contact
            RIKEN BioResource Center.
            E-mail: dnabank@brc.riken.jp
            URL:http://dna.brc.riken.jp/
FEATURES             Location/Qualifiers
     source          1..739
                     /cell_line="ARPE-19"
                     /cell_type="retinal pigment epithelium"
                     /clone="HP06370-ARh10H02"
                     /clone_lib="pGCAP1/ARPE-19 cDNA"
                     /db_xref="H-InvDB:HIT000563892"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="The library was prepared by Vector-capping method."
                     /organism="Homo sapiens"
     CDS             80..493
                     /codon_start=1
                     /gene="CRABP1"
                     /product="cellular retinoic acid-binding protein 1"
                     /protein_id="BAJ84031.1"
                     /transl_table=1
                     /translation="MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEI
                     RQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLE
                     GDGPKTYWTRELANDELILTFGADDVVCTRIYVRE"
BASE COUNT          158 a          220 c          205 g          156 t
ORIGIN      
        1 gccagtctcc gccttgcgag ctcagagtgt gcccgctgcg ccgccgctgt ccgtacctgc
       61 cgccgccgcc accgccacca tgcccaactt cgccggcacc tggaagatgc gcagcagcga
      121 gaatttcgac gagctgctga aggcactggg tgtgaacgcc atgctgagga aagtggccgt
      181 agcggctgcg tccaagccgc acgtggagat ccgccaggac ggggatcagt tctacatcaa
      241 gacatccacc acggtgcgca ccactgagat caacttcaag gtcggagaag gctttgagga
      301 ggagaccgtg gacggacgca agtgcaggag tttagccact tgggagaatg agaacaagat
      361 ccactgcacg caaactcttc ttgaagggga cggccccaaa acctactgga cccgtgagct
      421 ggccaacgat gaacttatcc tgacgtttgg cgccgatgac gtggtctgca ccagaattta
      481 tgtccgagag tgaaggcagc tggcttgctc ctactttcag gaagggatgc aggctcccct
      541 gaggaatatg tcatagttct gagctgccag tggaccgccc ttttccccta ccaatattag
      601 gtgatcccgt tttccccatg acaatgttgt agtgtccccc acccccaccc cccaggcctt
      661 ggtgcctctt gtatccctag tgctccatag tttggcattt gcacggtttc gaagtcatta
      721 aactggttag acgtgtctc
//