LOCUS AB593017 970 bp mRNA linear HUM 24-AUG-2011 DEFINITION Homo sapiens CRABP2 mRNA for cellular retinoic acid binding protein 2, complete cds, clone: HP03154-RBb04F08. ACCESSION AB593017 VERSION AB593017.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 970) AUTHORS Kato,S. TITLE Direct Submission JOURNAL Submitted (05-OCT-2010) to the DDBJ/EMBL/GenBank databases. Contact:Seishi Kato National Rehabilitation Center for Persons with Disabilities, Research Institute, Department of Rehabilitation Engineering; 4-1 Namiki, Tokorozawa, Saitama 359-8555, Japan URL :http://www.rehab.go.jp/ REFERENCE 2 AUTHORS Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M., Toyama,S., Usami,R., Ohtoko,K. and Kato,S. TITLE Full-Length Transcriptome Analysis of Human Retina-Derived Cell Lines ARPE-19 and Y79 Using the Vector-Capping Method JOURNAL Invest. Ophthalmol. Vis. Sci. 52, 6662-6670 (2011) COMMENT For cDNA clones and library availability, please contact RIKEN BioResource Center. E-mail: dnabank@brc.riken.jp URL:http://dna.brc.riken.jp/ FEATURES Location/Qualifiers source 1..970 /cell_line="Y79" /cell_type="retinoblastoma" /clone="HP03154-RBb04F08" /clone_lib="pKA1U5/Y79 cDNA" /db_xref="H-InvDB:HIT000563818" /db_xref="taxon:9606" /mol_type="mRNA" /note="The library was prepared by Vector-capping method." /organism="Homo sapiens" CDS 138..554 /codon_start=1 /gene="CRABP2" /product="cellular retinoic acid binding protein 2" /protein_id="BAJ83972.1" /transl_table=1 /translation="MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEI KQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLK GEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE" BASE COUNT 229 a 276 c 256 g 209 t ORIGIN 1 agctttgggg ttgtccctgg acttgtcttg gttccagaac ctgacgaccc ggcgacggcg 61 acgtctcttt tgactaaaag acagtgtcca gtgctccagc ctaggagtct acggggaccg 121 cctcccgcgc cgccaccatg cccaacttct ctggcaactg gaaaatcatc cgatcggaaa 181 acttcgagga attgctcaaa gtgctggggg tgaatgtgat gctgaggaag attgctgtgg 241 ctgcagcgtc caagccagca gtggagatca aacaggaggg agacactttc tacatcaaaa 301 cctccaccac cgtgcgcacc acagagatta acttcaaggt tggggaggag tttgaggagc 361 agactgtgga tgggaggccc tgtaagagcc tggtgaaatg ggagagtgag aataaaatgg 421 tctgtgagca gaagctcctg aagggagagg gccccaagac ctcgtggacc agagaactga 481 ccaacgatgg ggaactgatc ctgaccatga cggcggatga cgttgtgtgc accagggtct 541 acgtccgaga gtgagtggcc acaggtagaa ccgcggccga agcccaccac tggccatgct 601 caccgccctg cttcactgcc ccctccgtcc caccccctcc ttctaggata gcgctcccct 661 taccccagtc acttctgggg gtcactggga tgcctcttgc agggtcttgc tttctttgac 721 ctcttctctc ctcccctaca ccaacaaaga ggaatggctg caagagccca gatcacccat 781 tccgggttca ctccccgcct ccccaagtca gcagtcctag ccccaaacca gcccagagca 841 gggtctctct aaaggggact tgagggcctg agcaggaaag actggccctc tagcttctac 901 cctttgtccc tgtagcctat acagtttaga atatttattt gttaatttta ttaaaatgct 961 ttaaaaaaat //