LOCUS       AB593017                 970 bp    mRNA    linear   HUM 24-AUG-2011
DEFINITION  Homo sapiens CRABP2 mRNA for cellular retinoic acid binding
            protein 2, complete cds, clone: HP03154-RBb04F08.
ACCESSION   AB593017
VERSION     AB593017.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 970)
  AUTHORS   Kato,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Seishi Kato
            National Rehabilitation Center for Persons with Disabilities,
            Research Institute, Department of Rehabilitation Engineering; 4-1
            Namiki, Tokorozawa, Saitama 359-8555, Japan
            URL    :http://www.rehab.go.jp/
REFERENCE   2
  AUTHORS   Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M.,
            Toyama,S., Usami,R., Ohtoko,K. and Kato,S.
  TITLE     Full-Length Transcriptome Analysis of Human Retina-Derived Cell
            Lines ARPE-19 and Y79 Using the Vector-Capping Method
  JOURNAL   Invest. Ophthalmol. Vis. Sci. 52, 6662-6670 (2011)
COMMENT     For cDNA clones and library availability, please contact
            RIKEN BioResource Center.
            E-mail: dnabank@brc.riken.jp
            URL:http://dna.brc.riken.jp/
FEATURES             Location/Qualifiers
     source          1..970
                     /cell_line="Y79"
                     /cell_type="retinoblastoma"
                     /clone="HP03154-RBb04F08"
                     /clone_lib="pKA1U5/Y79 cDNA"
                     /db_xref="H-InvDB:HIT000563818"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="The library was prepared by Vector-capping method."
                     /organism="Homo sapiens"
     CDS             138..554
                     /codon_start=1
                     /gene="CRABP2"
                     /product="cellular retinoic acid binding protein 2"
                     /protein_id="BAJ83972.1"
                     /transl_table=1
                     /translation="MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEI
                     KQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLK
                     GEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE"
BASE COUNT          229 a          276 c          256 g          209 t
ORIGIN      
        1 agctttgggg ttgtccctgg acttgtcttg gttccagaac ctgacgaccc ggcgacggcg
       61 acgtctcttt tgactaaaag acagtgtcca gtgctccagc ctaggagtct acggggaccg
      121 cctcccgcgc cgccaccatg cccaacttct ctggcaactg gaaaatcatc cgatcggaaa
      181 acttcgagga attgctcaaa gtgctggggg tgaatgtgat gctgaggaag attgctgtgg
      241 ctgcagcgtc caagccagca gtggagatca aacaggaggg agacactttc tacatcaaaa
      301 cctccaccac cgtgcgcacc acagagatta acttcaaggt tggggaggag tttgaggagc
      361 agactgtgga tgggaggccc tgtaagagcc tggtgaaatg ggagagtgag aataaaatgg
      421 tctgtgagca gaagctcctg aagggagagg gccccaagac ctcgtggacc agagaactga
      481 ccaacgatgg ggaactgatc ctgaccatga cggcggatga cgttgtgtgc accagggtct
      541 acgtccgaga gtgagtggcc acaggtagaa ccgcggccga agcccaccac tggccatgct
      601 caccgccctg cttcactgcc ccctccgtcc caccccctcc ttctaggata gcgctcccct
      661 taccccagtc acttctgggg gtcactggga tgcctcttgc agggtcttgc tttctttgac
      721 ctcttctctc ctcccctaca ccaacaaaga ggaatggctg caagagccca gatcacccat
      781 tccgggttca ctccccgcct ccccaagtca gcagtcctag ccccaaacca gcccagagca
      841 gggtctctct aaaggggact tgagggcctg agcaggaaag actggccctc tagcttctac
      901 cctttgtccc tgtagcctat acagtttaga atatttattt gttaatttta ttaaaatgct
      961 ttaaaaaaat
//