LOCUS AB451491 501 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens IFNB1 mRNA for interferon beta precursor, partial cds, clone: FLJ08204DABN. ACCESSION AB451491 VERSION AB451491.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 501) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) - translational initiation codon (ATG) - FLAG (GATTATAAAGATGATGATGATAAA) - upstream of the coding sequence of the mature form and is also flanked with a spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the ORF. This is an N-type clone which has an intrinsic stop codon at the end of ORF. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC ATG GATTATAAAGATGATGATGATAAA 5'ORF3' G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaaca ggtcactatcagtcaaaataaaatcatt attg-3' (5'ORF3'; the coding sequence of the mature form. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..501 /clone="FLJ08204DABN" /db_xref="H-InvDB:HIT000487704" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS <1..501 /codon_start=1 /gene="IFNB1" /product="interferon beta precursor" /protein_id="BAG70305.1" /transl_table=1 /translation="MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEI KQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVL EEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN" BASE COUNT 159 a 104 c 116 g 122 t ORIGIN 1 atgagctaca acttgcttgg attcctacaa agaagcagca attttcagtg tcagaagctc 61 ctgtggcaat tgaatgggag gcttgaatat tgcctcaagg acaggatgaa ctttgacatc 121 cctgaggaga ttaagcagct gcagcagttc cagaaggagg acgccgcatt gaccatctat 181 gagatgctcc agaacatctt tgctattttc agacaagatt catctagcac tggctggaat 241 gagactattg ttgagaacct cctggctaat gtctatcatc agataaacca tctgaagaca 301 gtcctggaag aaaaactgga gaaagaagat ttcaccaggg gaaaactcat gagcagtctg 361 cacctgaaaa gatattatgg gaggattctg cattacctga aggccaagga gtacagtcac 421 tgtgcctgga ccatagtcag agtggaaatc ctaaggaact tttacttcat taacagactt 481 acaggttacc tccgaaacta a //