LOCUS       AB451491                 501 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens IFNB1 mRNA for interferon beta precursor, partial
            cds, clone: FLJ08204DABN.
ACCESSION   AB451491
VERSION     AB451491.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 501)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) - translational
            initiation codon (ATG) - FLAG (GATTATAAAGATGATGATGATAAA) -
            upstream of the coding sequence of the mature form and is also
            flanked with a spacer nucleotide (G) - attL2 sequence (99 nt)
            downstream of the ORF. This is an N-type clone which has an
            intrinsic stop codon at the end of ORF. DNA sequences of the
            entire ORF and flanking regions were validated by sequencing.
            Clone structure of the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC ATG
            GATTATAAAGATGATGATGATAAA 5'ORF3' G
            acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaaca
            ggtcactatcagtcaaaataaaatcatt attg-3' (5'ORF3'; the coding sequence
            of the mature form. attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..501
                     /clone="FLJ08204DABN"
                     /db_xref="H-InvDB:HIT000487704"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             <1..501
                     /codon_start=1
                     /gene="IFNB1"
                     /product="interferon beta precursor"
                     /protein_id="BAG70305.1"
                     /transl_table=1
                     /translation="MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEI
                     KQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVL
                     EEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL
                     TGYLRN"
BASE COUNT          159 a          104 c          116 g          122 t
ORIGIN      
        1 atgagctaca acttgcttgg attcctacaa agaagcagca attttcagtg tcagaagctc
       61 ctgtggcaat tgaatgggag gcttgaatat tgcctcaagg acaggatgaa ctttgacatc
      121 cctgaggaga ttaagcagct gcagcagttc cagaaggagg acgccgcatt gaccatctat
      181 gagatgctcc agaacatctt tgctattttc agacaagatt catctagcac tggctggaat
      241 gagactattg ttgagaacct cctggctaat gtctatcatc agataaacca tctgaagaca
      301 gtcctggaag aaaaactgga gaaagaagat ttcaccaggg gaaaactcat gagcagtctg
      361 cacctgaaaa gatattatgg gaggattctg cattacctga aggccaagga gtacagtcac
      421 tgtgcctgga ccatagtcag agtggaaatc ctaaggaact tttacttcat taacagactt
      481 acaggttacc tccgaaacta a
//