LOCUS       AB451481                1095 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens PTGER3 mRNA for prostaglandin E receotor EP3 subtype
            3 isoform, partial cds, clone: FLJ80357SAAF.
ACCESSION   AB451481
VERSION     AB451481.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1095)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..1095
                     /clone="FLJ80357SAAF"
                     /db_xref="H-InvDB:HIT000487694"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>1095
                     /codon_start=1
                     /gene="PTGER3"
                     /product="prostaglandin E receotor EP3 subtype 3 isoform"
                     /protein_id="BAG70295.1"
                     /transl_table=1
                     /translation="MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSG
                     EDCGSVSVAFPITMLLTGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVG
                     QLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIR
                     APHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNG
                     TSSSHNWGNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRI
                     TTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRL
                     ASLNQILDPWVYLLLRKILLRKFCQEEFWGN"
BASE COUNT          182 a          344 c          329 g          240 t
ORIGIN      
        1 atgaaggaga cccggggcta cggaggggat gcccccttct gcacccgcct caaccactcc
       61 tacacaggca tgtgggcgcc cgagcgttcc gccgaggcgc ggggcaacct cacgcgccct
      121 ccagggtctg gcgaggattg cggatcggtg tccgtggcct tcccgatcac catgctgctc
      181 actggtttcg tgggcaacgc actggccatg ctgctcgtgt cgcgcagcta ccggcgccgg
      241 gagagcaagc gcaagaagtc cttcctgctg tgcatcggct ggctggcgct caccgacctg
      301 gtcgggcagc ttctcaccac cccggtcgtc atcgtcgtgt acctgtccaa gcagcgttgg
      361 gagcacatcg acccgtcggg gcggctctgc acctttttcg ggctgaccat gactgttttc
      421 gggctctcct cgttgttcat cgccagcgcc atggccgtcg agcgggcgct ggccatcagg
      481 gcgccgcact ggtatgcgag ccacatgaag acgcgtgcca cccgcgctgt gctgctcggc
      541 gtgtggctgg ccgtgctcgc cttcgccctg ctgccggtgc tgggcgtggg ccagtacacc
      601 gtccagtggc ccgggacgtg gtgcttcatc agcaccgggc gagggggcaa cgggactagc
      661 tcttcgcata actggggcaa ccttttcttc gcctctgcct ttgccttcct ggggctcttg
      721 gcgctgacag tcaccttttc ctgcaacctg gccaccatta aggccctggt gtcccgctgc
      781 cgggccaagg ccacggcatc tcagtccagt gcccagtggg gccgcatcac gaccgagacg
      841 gccattcagc ttatggggat catgtgcgtg ctgtcggtct gctggtctcc gctcctgata
      901 atgatgttga aaatgatctt caatcagaca tcagttgagc actgcaagac acacacggag
      961 aagcagaaag aatgcaactt cttcttaata gctgttcgcc tggcttcact gaaccagatc
     1021 ttggatcctt gggtttacct gctgttaaga aagatccttc ttcgaaagtt ttgccaagag
     1081 gaattttggg gaaat
//