LOCUS AB451481 1095 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens PTGER3 mRNA for prostaglandin E receotor EP3 subtype 3 isoform, partial cds, clone: FLJ80357SAAF. ACCESSION AB451481 VERSION AB451481.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1095) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..1095 /clone="FLJ80357SAAF" /db_xref="H-InvDB:HIT000487694" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>1095 /codon_start=1 /gene="PTGER3" /product="prostaglandin E receotor EP3 subtype 3 isoform" /protein_id="BAG70295.1" /transl_table=1 /translation="MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSG EDCGSVSVAFPITMLLTGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVG QLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIR APHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNG TSSSHNWGNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRI TTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRL ASLNQILDPWVYLLLRKILLRKFCQEEFWGN" BASE COUNT 182 a 344 c 329 g 240 t ORIGIN 1 atgaaggaga cccggggcta cggaggggat gcccccttct gcacccgcct caaccactcc 61 tacacaggca tgtgggcgcc cgagcgttcc gccgaggcgc ggggcaacct cacgcgccct 121 ccagggtctg gcgaggattg cggatcggtg tccgtggcct tcccgatcac catgctgctc 181 actggtttcg tgggcaacgc actggccatg ctgctcgtgt cgcgcagcta ccggcgccgg 241 gagagcaagc gcaagaagtc cttcctgctg tgcatcggct ggctggcgct caccgacctg 301 gtcgggcagc ttctcaccac cccggtcgtc atcgtcgtgt acctgtccaa gcagcgttgg 361 gagcacatcg acccgtcggg gcggctctgc acctttttcg ggctgaccat gactgttttc 421 gggctctcct cgttgttcat cgccagcgcc atggccgtcg agcgggcgct ggccatcagg 481 gcgccgcact ggtatgcgag ccacatgaag acgcgtgcca cccgcgctgt gctgctcggc 541 gtgtggctgg ccgtgctcgc cttcgccctg ctgccggtgc tgggcgtggg ccagtacacc 601 gtccagtggc ccgggacgtg gtgcttcatc agcaccgggc gagggggcaa cgggactagc 661 tcttcgcata actggggcaa ccttttcttc gcctctgcct ttgccttcct ggggctcttg 721 gcgctgacag tcaccttttc ctgcaacctg gccaccatta aggccctggt gtcccgctgc 781 cgggccaagg ccacggcatc tcagtccagt gcccagtggg gccgcatcac gaccgagacg 841 gccattcagc ttatggggat catgtgcgtg ctgtcggtct gctggtctcc gctcctgata 901 atgatgttga aaatgatctt caatcagaca tcagttgagc actgcaagac acacacggag 961 aagcagaaag aatgcaactt cttcttaata gctgttcgcc tggcttcact gaaccagatc 1021 ttggatcctt gggtttacct gctgttaaga aagatccttc ttcgaaagtt ttgccaagag 1081 gaattttggg gaaat //