LOCUS AB451468 801 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens PSMG1 mRNA for Down syndrome critical region protein 2 isoform b, partial cds, clone: FLJ10593SAAF. ACCESSION AB451468 VERSION AB451468.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 801) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..801 /clone="FLJ10593SAAF" /db_xref="H-InvDB:HIT000487681" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>801 /codon_start=1 /gene="PSMG1" /product="Down syndrome critical region protein 2 isoform b" /protein_id="BAG70282.1" /transl_table=1 /translation="MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARK REVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLW NEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFGSCPRKNMQITILTCRHVTDYKTSEST GSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDV MKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT" BASE COUNT 236 a 163 c 194 g 208 t ORIGIN 1 atggcggcca cgttcttcgg agaggtggtg aaggcgccgt gccgagctgg gactgaggac 61 gaagaggagg aggaggaggg gcggagggag acgcccgagg acagggaggt gcgtctgcag 121 ctggcgcgga agagggaagt gcggctcctt cgaagacaaa caaaaacatc tttggaagtt 181 tctttgctag aaaaatatcc gtgctccaag tttataattg ctataggaaa taatgcagta 241 gcatttctgt catcatttgt tatgaattca ggagtctggg aggaagttgg ttgtgctaaa 301 ctctggaatg aatggtgtag aacaacagac actacacatc tgtcctccac agaggctttt 361 tgtgtgtttt atcatctaaa atccaatccc tcggtttttg gctcttgtcc aaggaagaac 421 atgcagataa ctattctcac atgtcgacat gttaccgatt ataaaacctc agaatccacc 481 ggcagccttc cttctccttt cctgagagcc ctaaaaacac agaatttcaa agactcggcg 541 tgttgtccat tgctagaaca accgaatata gtacacgacc ttcctgcagc agttctaagc 601 tactgtcaag tatggaaaat cccggcaatt ctgtacttgt gttatactga tgtgatgaaa 661 ttagacctaa tcacagtgga agcttttaag cctatacttt ctaccagaag cttgaagggt 721 ttggttaaga atattcccca aagcactgag atactaaaga aattgatgac aacaaatgag 781 attcagagta acatttatac a //