LOCUS       AB451468                 801 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens PSMG1 mRNA for Down syndrome critical region protein
            2 isoform b, partial cds, clone: FLJ10593SAAF.
ACCESSION   AB451468
VERSION     AB451468.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 801)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..801
                     /clone="FLJ10593SAAF"
                     /db_xref="H-InvDB:HIT000487681"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>801
                     /codon_start=1
                     /gene="PSMG1"
                     /product="Down syndrome critical region protein 2 isoform
                     b"
                     /protein_id="BAG70282.1"
                     /transl_table=1
                     /translation="MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARK
                     REVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLW
                     NEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFGSCPRKNMQITILTCRHVTDYKTSEST
                     GSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDV
                     MKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT"
BASE COUNT          236 a          163 c          194 g          208 t
ORIGIN      
        1 atggcggcca cgttcttcgg agaggtggtg aaggcgccgt gccgagctgg gactgaggac
       61 gaagaggagg aggaggaggg gcggagggag acgcccgagg acagggaggt gcgtctgcag
      121 ctggcgcgga agagggaagt gcggctcctt cgaagacaaa caaaaacatc tttggaagtt
      181 tctttgctag aaaaatatcc gtgctccaag tttataattg ctataggaaa taatgcagta
      241 gcatttctgt catcatttgt tatgaattca ggagtctggg aggaagttgg ttgtgctaaa
      301 ctctggaatg aatggtgtag aacaacagac actacacatc tgtcctccac agaggctttt
      361 tgtgtgtttt atcatctaaa atccaatccc tcggtttttg gctcttgtcc aaggaagaac
      421 atgcagataa ctattctcac atgtcgacat gttaccgatt ataaaacctc agaatccacc
      481 ggcagccttc cttctccttt cctgagagcc ctaaaaacac agaatttcaa agactcggcg
      541 tgttgtccat tgctagaaca accgaatata gtacacgacc ttcctgcagc agttctaagc
      601 tactgtcaag tatggaaaat cccggcaatt ctgtacttgt gttatactga tgtgatgaaa
      661 ttagacctaa tcacagtgga agcttttaag cctatacttt ctaccagaag cttgaagggt
      721 ttggttaaga atattcccca aagcactgag atactaaaga aattgatgac aacaaatgag
      781 attcagagta acatttatac a
//