LOCUS       AB451463                 735 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens PRRX1 mRNA for paired mesoderm homeobox 1 isoform
            pmx-1b, partial cds, clone: FLJ09016AAAF.
ACCESSION   AB451463
VERSION     AB451463.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 735)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..735
                     /clone="FLJ09016AAAF"
                     /db_xref="H-InvDB:HIT000487676"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>735
                     /codon_start=1
                     /gene="PRRX1"
                     /product="paired mesoderm homeobox 1 isoform pmx-1b"
                     /protein_id="BAG70277.1"
                     /transl_table=1
                     /translation="MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEE
                     AGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFN
                     SSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANK
                     NASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNSPAQGI
                     NMANSIANLRLKAKEYSLQRNQVPTVN"
BASE COUNT          191 a          213 c          212 g          119 t
ORIGIN      
        1 atgacctcca gctacgggca cgttctggag cggcaaccgg cgctgggcgg ccgcttggac
       61 agcccgggca acctcgacac cctgcaggcg aaaaagaact tctccgtcag tcacctgcta
      121 gacctggagg aagccgggga catggtggcg gcacaggcgg atgagaacgt gggcgaggct
      181 ggccggagcc tgctggagtc gccgggactc accagcggca gcgacacccc gcagcaggac
      241 aatgaccagc tgaactcaga agaaaaaaag aagagaaagc agcgaaggaa taggacaacc
      301 ttcaatagca gccagctgca ggctttggag cgtgtctttg agcggacaca ctatcctgat
      361 gcttttgtgc gagaagacct tgcccgccgg gtgaacctca ccgaggcgag agtgcaggtg
      421 tggtttcaga accgaagagc caagttccgc aggaatgaga gagccatgct agccaataaa
      481 aacgcttccc tcctcaaatc ctactcagga gacgtgactg ctgtggagca gcccatcgta
      541 cctcgtcctg ctccgagacc caccgattat ctctcctggg ggacagcgtc tccgtacagc
      601 gccatggcta cttattctgc cacatgtgcc aacaatagcc ctgcacaggg catcaacatg
      661 gccaacagca ttgccaacct gagactgaag gccaaggaat atagtttaca gaggaaccag
      721 gtgccaacag tcaac
//