LOCUS AB451463 735 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens PRRX1 mRNA for paired mesoderm homeobox 1 isoform pmx-1b, partial cds, clone: FLJ09016AAAF. ACCESSION AB451463 VERSION AB451463.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 735) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..735 /clone="FLJ09016AAAF" /db_xref="H-InvDB:HIT000487676" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>735 /codon_start=1 /gene="PRRX1" /product="paired mesoderm homeobox 1 isoform pmx-1b" /protein_id="BAG70277.1" /transl_table=1 /translation="MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEE AGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFN SSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANK NASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNSPAQGI NMANSIANLRLKAKEYSLQRNQVPTVN" BASE COUNT 191 a 213 c 212 g 119 t ORIGIN 1 atgacctcca gctacgggca cgttctggag cggcaaccgg cgctgggcgg ccgcttggac 61 agcccgggca acctcgacac cctgcaggcg aaaaagaact tctccgtcag tcacctgcta 121 gacctggagg aagccgggga catggtggcg gcacaggcgg atgagaacgt gggcgaggct 181 ggccggagcc tgctggagtc gccgggactc accagcggca gcgacacccc gcagcaggac 241 aatgaccagc tgaactcaga agaaaaaaag aagagaaagc agcgaaggaa taggacaacc 301 ttcaatagca gccagctgca ggctttggag cgtgtctttg agcggacaca ctatcctgat 361 gcttttgtgc gagaagacct tgcccgccgg gtgaacctca ccgaggcgag agtgcaggtg 421 tggtttcaga accgaagagc caagttccgc aggaatgaga gagccatgct agccaataaa 481 aacgcttccc tcctcaaatc ctactcagga gacgtgactg ctgtggagca gcccatcgta 541 cctcgtcctg ctccgagacc caccgattat ctctcctggg ggacagcgtc tccgtacagc 601 gccatggcta cttattctgc cacatgtgcc aacaatagcc ctgcacaggg catcaacatg 661 gccaacagca ttgccaacct gagactgaag gccaaggaat atagtttaca gaggaaccag 721 gtgccaacag tcaac //