LOCUS       AB451449                1407 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens TRAIP mRNA for TRAF interacting protein, partial cds,
            clone: FLJ08192AAAF.
ACCESSION   AB451449
VERSION     AB451449.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1407)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..1407
                     /clone="FLJ08192AAAF"
                     /db_xref="H-InvDB:HIT000487662"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>1407
                     /codon_start=1
                     /gene="TRAIP"
                     /product="TRAF interacting protein"
                     /protein_id="BAG70263.1"
                     /transl_table=1
                     /translation="MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSR
                     TCPQCRIQVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQV
                     IIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLR
                     SKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKAS
                     GEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDLQSADKEIMSLKKKLTMLQE
                     TLNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQH
                     GYYEKLCLEKSHSPIQNVPKKICKGPRKESQLSLGGQSCAGEPDEELVGAFPIFVRNA
                     ILGQKQPKRPRSESSCSKDVVRTGFDGLGGRTKFIQPTDTVMIRPLPVKPKTKVKQRV
                     RVKTVPSLFQAKLDTFLWS"
BASE COUNT          375 a          364 c          384 g          284 t
ORIGIN      
        1 atgcctatcc gtgctctgtg cactatctgc tccgacttct tcgatcactc ccgcgacgtg
       61 gccgccatcc actgcggcca caccttccac ttgcagtgct taattcagtg gtttgagaca
      121 gcaccaagtc ggacctgccc acagtgccga atccaggttg gcaaaagaac tattatcaat
      181 aagctcttct ttgatcttgc ccaggaggag gagaatgtct tggatgcaga attcttaaag
      241 aatgaactgg acaatgtcag agcccagctt tcccagaaag acaaggagaa acgagacagc
      301 caggtcatca tcgacactct gcgggatacg ctggaagaac gcaatgctac tgtggtatct
      361 ctgcagcagg ccttgggcaa ggccgagatg ctgtgctcca cactgaaaaa gcagatgaag
      421 tacttagagc agcagcagga tgagaccaaa caagcacaag aggaggcccg ccggctcagg
      481 agcaagatga agaccatgga gcagattgag cttctactcc agagccagcg ccctgaggtg
      541 gaggagatga tccgagacat gggtgtggga cagtcagcgg tggaacagct ggctgtgtac
      601 tgtgtgtctc tcaagaaaga gtacgagaat ctaaaagagg cacggaaggc ctcaggggag
      661 gtggctgaca agctgaggaa ggatttgttt tcctccagaa gcaagttgca gacagtctac
      721 tctgaattgg atcaggccaa gttagaactg aagtcagccc agaaggactt acagagtgct
      781 gacaaggaaa tcatgagcct gaaaaagaag ctaacgatgc tgcaggaaac cttgaacctg
      841 ccaccagtgg ccagtgagac tgtcgaccgc ctggttttag agagcccagc ccctgtggag
      901 gtgaatctga agctccgccg gccatccttc cgtgatgata ttgatctcaa tgctaccttt
      961 gatgtggata ctcccccagc ccggccctcc agctcccagc atggttacta cgaaaaactt
     1021 tgcctagaga agtcacactc cccaattcag aatgtcccca agaagatatg caaaggcccc
     1081 aggaaggagt cccagctctc actgggtggc cagagctgtg caggagagcc agatgaggaa
     1141 ctggttggtg ccttccctat ttttgtccgg aatgccatcc taggccagaa acagcccaag
     1201 aggcccaggt cagagtcctc ttgcagcaaa gatgtggtaa ggacaggctt cgatgggctc
     1261 ggtggccgga caaaattcat ccagcctact gacacagtca tgatccgccc attgcctgtt
     1321 aagcccaaga ccaaggttaa gcagagggtg agggtgaaga cagtgccttc tctcttccag
     1381 gccaagctgg acaccttcct gtggtcg
//