LOCUS AB451449 1407 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens TRAIP mRNA for TRAF interacting protein, partial cds, clone: FLJ08192AAAF. ACCESSION AB451449 VERSION AB451449.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1407) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..1407 /clone="FLJ08192AAAF" /db_xref="H-InvDB:HIT000487662" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>1407 /codon_start=1 /gene="TRAIP" /product="TRAF interacting protein" /protein_id="BAG70263.1" /transl_table=1 /translation="MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSR TCPQCRIQVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQV IIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLR SKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKAS GEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDLQSADKEIMSLKKKLTMLQE TLNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQH GYYEKLCLEKSHSPIQNVPKKICKGPRKESQLSLGGQSCAGEPDEELVGAFPIFVRNA ILGQKQPKRPRSESSCSKDVVRTGFDGLGGRTKFIQPTDTVMIRPLPVKPKTKVKQRV RVKTVPSLFQAKLDTFLWS" BASE COUNT 375 a 364 c 384 g 284 t ORIGIN 1 atgcctatcc gtgctctgtg cactatctgc tccgacttct tcgatcactc ccgcgacgtg 61 gccgccatcc actgcggcca caccttccac ttgcagtgct taattcagtg gtttgagaca 121 gcaccaagtc ggacctgccc acagtgccga atccaggttg gcaaaagaac tattatcaat 181 aagctcttct ttgatcttgc ccaggaggag gagaatgtct tggatgcaga attcttaaag 241 aatgaactgg acaatgtcag agcccagctt tcccagaaag acaaggagaa acgagacagc 301 caggtcatca tcgacactct gcgggatacg ctggaagaac gcaatgctac tgtggtatct 361 ctgcagcagg ccttgggcaa ggccgagatg ctgtgctcca cactgaaaaa gcagatgaag 421 tacttagagc agcagcagga tgagaccaaa caagcacaag aggaggcccg ccggctcagg 481 agcaagatga agaccatgga gcagattgag cttctactcc agagccagcg ccctgaggtg 541 gaggagatga tccgagacat gggtgtggga cagtcagcgg tggaacagct ggctgtgtac 601 tgtgtgtctc tcaagaaaga gtacgagaat ctaaaagagg cacggaaggc ctcaggggag 661 gtggctgaca agctgaggaa ggatttgttt tcctccagaa gcaagttgca gacagtctac 721 tctgaattgg atcaggccaa gttagaactg aagtcagccc agaaggactt acagagtgct 781 gacaaggaaa tcatgagcct gaaaaagaag ctaacgatgc tgcaggaaac cttgaacctg 841 ccaccagtgg ccagtgagac tgtcgaccgc ctggttttag agagcccagc ccctgtggag 901 gtgaatctga agctccgccg gccatccttc cgtgatgata ttgatctcaa tgctaccttt 961 gatgtggata ctcccccagc ccggccctcc agctcccagc atggttacta cgaaaaactt 1021 tgcctagaga agtcacactc cccaattcag aatgtcccca agaagatatg caaaggcccc 1081 aggaaggagt cccagctctc actgggtggc cagagctgtg caggagagcc agatgaggaa 1141 ctggttggtg ccttccctat ttttgtccgg aatgccatcc taggccagaa acagcccaag 1201 aggcccaggt cagagtcctc ttgcagcaaa gatgtggtaa ggacaggctt cgatgggctc 1261 ggtggccgga caaaattcat ccagcctact gacacagtca tgatccgccc attgcctgtt 1321 aagcccaaga ccaaggttaa gcagagggtg agggtgaaga cagtgccttc tctcttccag 1381 gccaagctgg acaccttcct gtggtcg //