LOCUS AB451427 1125 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens GPER mRNA for G protein-coupled receptor 30, partial cds, clone: FLJ08141AAAF. ACCESSION AB451427 VERSION AB451427.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1125) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..1125 /clone="FLJ08141AAAF" /db_xref="H-InvDB:HIT000487640" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>1125 /codon_start=1 /gene="GPER" /product="G protein-coupled receptor 30" /protein_id="BAG70241.1" /transl_table=1 /translation="MDVTSQARGVGLEMYLGTAQPAAPNTTSPELNLSHPLLGTALAN GTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLA VADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALA RAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLE VTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPEN VFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDK LRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV" BASE COUNT 184 a 401 c 304 g 236 t ORIGIN 1 atggatgtga cttcccaagc ccggggcgtg ggcctggaga tgtacctagg caccgcgcag 61 cctgcggccc ccaacaccac ctcccccgag ctcaacctgt cccacccgct cctgggcacc 121 gccctggcca atgggacagg tgagctctcg gagcaccagc agtacgtgat cggcctgttc 181 ctctcgtgcc tctacaccat cttcctcttc cccatcggct ttgtgggcaa catcctgatc 241 ctggtggtga acatcagctt ccgcgagaag atgaccatcc ccgacctgta cttcatcaac 301 ctggcggtgg cggacctcat cctggtggcc gactccctca ttgaggtgtt caacctgcac 361 gagcggtact acgacatcgc cgtcctgtgc accttcatgt cgctcttcct gcaggtcaac 421 atgtacagca gcgtcttctt cctcacctgg atgagcttcg accgctacat cgccctggcc 481 agggccatgc gctgcagcct gttccgcacc aagcaccacg cccggctgag ctgtggcctc 541 atctggatgg catccgtgtc agccacgctg gtgcccttca ccgccgtgca cctgcagcac 601 accgacgagg cctgcttctg tttcgcggat gtccgggagg tgcagtggct cgaggtcacg 661 ctgggcttca tcgtgccctt cgccatcatc ggcctgtgct actccctcat tgtccgggtg 721 ctggtcaggg cgcaccggca ccgtgggctg cggccccggc ggcagaaggc gctccgcatg 781 atcctcgcag tggtgctggt cttcttcgtc tgctggctgc cggagaacgt cttcatcagc 841 gtgcacctcc tgcagcggac gcagcctggg gccgctccct gcaagcagtc tttccgccat 901 gcccaccccc tcacgggcca cattgtcaac ctcgccgcct tctccaacag ctgcctaaac 961 cccctcatct acagctttct cggggagacc ttcagggaca agctgaggct gtacattgag 1021 cagaaaacaa atttgccggc cctgaaccgc ttctgtcacg ctgccctgaa ggccgtcatt 1081 ccagacagca ctgagcagtc ggatgtgagg ttcagcagtg ccgtg //