LOCUS AB451416 534 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens CAV1 mRNA for caveolin 1, partial cds, clone: FLJ08122AAAF. ACCESSION AB451416 VERSION AB451416.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 534) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..534 /clone="FLJ08122AAAF" /db_xref="H-InvDB:HIT000487629" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>534 /codon_start=1 /gene="CAV1" /product="caveolin 1" /protein_id="BAG70230.1" /transl_table=1 /translation="MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDA HTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRL LSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLF EAVGKIFSNVRINLQKEI" BASE COUNT 140 a 145 c 124 g 125 t ORIGIN 1 atgtctgggg gcaaatacgt agactcggag ggacatctct acaccgttcc catccgggaa 61 cagggcaaca tctacaagcc caacaacaag gccatggcag acgagctgag cgagaagcaa 121 gtgtacgacg cgcacaccaa ggagatcgac ctggtcaacc gcgaccctaa acacctcaac 181 gatgacgtgg tcaagattga ctttgaagat gtgattgcag aaccagaagg gacacacagt 241 tttgacggca tttggaaggc cagcttcacc accttcactg tgacgaaata ctggttttac 301 cgcttgctgt ctgccctctt tggcatcccg atggcactca tctggggcat ttacttcgcc 361 attctctctt tcctgcacat ctgggcagtt gtaccatgca ttaagagctt cctgattgag 421 attcagtgca tcagccgtgt ctattccatc tacgtccaca ccgtctgtga cccactcttt 481 gaagctgttg ggaaaatatt cagcaatgtc cgcatcaact tgcagaaaga aata //