LOCUS       AB451404                 732 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens KLF9 mRNA for Kruppel-like factor 9, partial cds,
            clone: FLJ08107AAAF.
ACCESSION   AB451404
VERSION     AB451404.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 732)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..732
                     /clone="FLJ08107AAAF"
                     /db_xref="H-InvDB:HIT000487617"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>732
                     /codon_start=1
                     /gene="KLF9"
                     /product="Kruppel-like factor 9"
                     /protein_id="BAG70218.1"
                     /transl_table=1
                     /translation="MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVT
                     KEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTE
                     SGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHL
                     KAHYRVHTGERPFPCTWLDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHL
                     TKHARRHTEFHPSMIKRSKKALANAL"
BASE COUNT          166 a          234 c          209 g          123 t
ORIGIN      
        1 atgtccgcgg ccgcctacat ggacttcgtg gctgcccagt gtctggtttc catttcgaac
       61 cgcgctgcgg tgccggagca tggggtcgct ccggacgccg agcggctgcg actacctgag
      121 cgcgaggtga ccaaggagca cggtgacccg ggggacacct ggaaggatta ctgcacactg
      181 gtcaccatcg ccaagagctt gttggacctg aacaagtacc gacccatcca gaccccctcc
      241 gtgtgcagcg acagtctgga aagtccagat gaggatatgg gatccgacag cgacgtgacc
      301 accgaatctg ggtcgagtcc ttcccacagc ccggaggaga gacaggatcc tggcagcgcg
      361 cccagcccgc tctccctcct ccatcctgga gtggctgcga aggggaaaca cgcctccgaa
      421 aagaggcaca agtgccccta cagtggctgt gggaaagtct atggaaaatc ctcccatctc
      481 aaagcccatt acagagtgca tacaggtgaa cggccctttc cctgcacgtg gctagactgc
      541 cttaaaaagt tctcccgctc agacgagctg acccgccact accggaccca cactggggaa
      601 aagcagttcc gctgtccgct gtgtgagaag cgcttcatga ggagtgacca cctcacaaag
      661 cacgcccggc ggcacaccga gttccacccc agcatgatca agcgatcgaa aaaggcgctg
      721 gccaacgctt tg
//