LOCUS AB451404 732 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens KLF9 mRNA for Kruppel-like factor 9, partial cds, clone: FLJ08107AAAF. ACCESSION AB451404 VERSION AB451404.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 732) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..732 /clone="FLJ08107AAAF" /db_xref="H-InvDB:HIT000487617" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>732 /codon_start=1 /gene="KLF9" /product="Kruppel-like factor 9" /protein_id="BAG70218.1" /transl_table=1 /translation="MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVT KEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTE SGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHL KAHYRVHTGERPFPCTWLDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHL TKHARRHTEFHPSMIKRSKKALANAL" BASE COUNT 166 a 234 c 209 g 123 t ORIGIN 1 atgtccgcgg ccgcctacat ggacttcgtg gctgcccagt gtctggtttc catttcgaac 61 cgcgctgcgg tgccggagca tggggtcgct ccggacgccg agcggctgcg actacctgag 121 cgcgaggtga ccaaggagca cggtgacccg ggggacacct ggaaggatta ctgcacactg 181 gtcaccatcg ccaagagctt gttggacctg aacaagtacc gacccatcca gaccccctcc 241 gtgtgcagcg acagtctgga aagtccagat gaggatatgg gatccgacag cgacgtgacc 301 accgaatctg ggtcgagtcc ttcccacagc ccggaggaga gacaggatcc tggcagcgcg 361 cccagcccgc tctccctcct ccatcctgga gtggctgcga aggggaaaca cgcctccgaa 421 aagaggcaca agtgccccta cagtggctgt gggaaagtct atggaaaatc ctcccatctc 481 aaagcccatt acagagtgca tacaggtgaa cggccctttc cctgcacgtg gctagactgc 541 cttaaaaagt tctcccgctc agacgagctg acccgccact accggaccca cactggggaa 601 aagcagttcc gctgtccgct gtgtgagaag cgcttcatga ggagtgacca cctcacaaag 661 cacgcccggc ggcacaccga gttccacccc agcatgatca agcgatcgaa aaaggcgctg 721 gccaacgctt tg //