LOCUS       AB451403                 678 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens TXNDC9 mRNA for ATP binding protein associated with
            cell differentiation, partial cds, clone: FLJ08106AAAF.
ACCESSION   AB451403
VERSION     AB451403.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..678
                     /clone="FLJ08106AAAF"
                     /db_xref="H-InvDB:HIT000487616"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>678
                     /codon_start=1
                     /gene="TXNDC9"
                     /product="ATP binding protein associated with cell
                     differentiation"
                     /protein_id="BAG70217.1"
                     /transl_table=1
                     /translation="MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDEL
                     ERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTF
                     RCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVG
                     FTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKK
                     YDSDSDDD"
BASE COUNT          246 a          122 c          146 g          164 t
ORIGIN      
        1 atggaagctg atgcatctgt tgacatgttt tccaaagtcc tggagcatca gctgcttcag
       61 actaccaaac tggtggaaga acatttggat tctgaaattc aaaaactgga tcagatggat
      121 gaggatgaat tggaacgcct taaagaaaag agactccagg cactaaggaa agctcaacag
      181 cagaaacaag aatggctttc taaaggacat ggggaataca gagaaatccc tagtgaaaga
      241 gacttttttc aagaagtcaa ggagagtgaa aatgtggttt gccatttcta cagagactcc
      301 acattcaggt gtaaaatact agacagacat ctggcaatat tgtccaagaa acacctcgag
      361 accaaatttt tgaagctgaa tgtggaaaaa gcacctttcc tttgtgagag actgcatatc
      421 aaagtcattc ccacactagc actgctaaaa gatgggaaaa cacaagatta tgttgttggg
      481 tttactgacc taggaaatac agatgacttc accacagaaa ctttagaatg gaggctcggt
      541 tcttctgaca ttcttaatta cagtggaaat ttaatggagc caccatttca gaaccaaaag
      601 aaatttggaa caaacttcac aaagctggaa aagaaaacta tccgaggaaa gaaatatgat
      661 tcagactctg atgatgat
//