LOCUS AB451391 408 bp mRNA linear HUM 02-SEP-2008
DEFINITION Homo sapiens SRP14 mRNA for signal recognition particle 14 kDa
protein, partial cds, clone: FLJ08081AAAF.
ACCESSION AB451391
VERSION AB451391.1
KEYWORDS Gateway cloning system.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 408)
AUTHORS Kawamura,Y., Nomura,N. and Goshima,N.
TITLE Direct Submission
JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
Contact:Naoki Goshima
Biomedicinal Information Research Center (BIRC), National
Institute of Advanced Industrial Science and Technology (AIST);
2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE 2
AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
Imai,J.-I., Watanabe,S. and Nomura,N.
TITLE Human Protein Factory: an infrastructure to convert the human
transcriptome into the in vitro-expressed human proteome of
versatile utility
JOURNAL Unpublished (2008)
COMMENT This human Gateway entry clone was constructed by recombining an
attB-attached open reading frame (ORF) fragment with attP
sequences of the Gateway donor vector pDONR201. The ORF sequence
in the entry clone is flanked with attL1 sequence (100 nt) -
spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
translational initiation codon (ATG) and is also flanked with
spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
the ORF. This is an F-type clone that deletes the stop codon for
C-terminal tagged proteins. DNA sequences of the entire ORF and
flanking regions were validated by sequencing. Clone structure of
the ORF and flanking sequences is as follows:
5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
attL sequences are described in lower cases).
Clone information: http://www.HGPD.jp/
This clone was produced in the "Functional Analysis of Protein and
Research Application" project supported by the New Energy and
Industrial Technology Development Organization (NEDO), Japan
FEATURES Location/Qualifiers
source 1..408
/clone="FLJ08081AAAF"
/db_xref="H-InvDB:HIT000487604"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="Vector: pDONR201"
/organism="Homo sapiens"
CDS 1..>408
/codon_start=1
/gene="SRP14"
/product="signal recognition particle 14 kDa protein"
/protein_id="BAG70205.1"
/transl_table=1
/translation="MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKG
TVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNK
TKKTKAAAAAAAAAPAAAATAATTAATTAATAAQ"
BASE COUNT 139 a 93 c 111 g 65 t
ORIGIN
1 atggtgttgt tggagagcga gcagttcctg acggagctga ccagactttt ccagaagtgc
61 cggacgtcgg gcagcgtcta tatcaccttg aagaagtatg acggtcgaac caaacccatt
121 ccaaagaaag gtactgtgga gggctttgag cccgcagaca acaagtgtct gttaagagct
181 accgatggga agaagaagat cagcactgtg gtgagctcca aggaagtgaa taagtttcag
241 atggcttatt caaacctcct tagagctaac atggatgggt tgaagaagag agacaaaaag
301 aacaaaacta agaagaccaa agcagcagca gcagcagcag cagcagcacc tgccgcagca
361 gcaacagcag caacaacagc agcaacaaca gcagcaacag cagcacag
//