LOCUS AB451379 1752 bp mRNA linear HUM 02-SEP-2008
DEFINITION Homo sapiens SHC1 mRNA for SHC-transforming protein 1, partial
cds, clone: FLJ08067AAAF.
ACCESSION AB451379
VERSION AB451379.1
KEYWORDS Gateway cloning system.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1752)
AUTHORS Kawamura,Y., Nomura,N. and Goshima,N.
TITLE Direct Submission
JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
Contact:Naoki Goshima
Biomedicinal Information Research Center (BIRC), National
Institute of Advanced Industrial Science and Technology (AIST);
2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE 2
AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
Imai,J.-I., Watanabe,S. and Nomura,N.
TITLE Human Protein Factory: an infrastructure to convert the human
transcriptome into the in vitro-expressed human proteome of
versatile utility
JOURNAL Unpublished (2008)
COMMENT This human Gateway entry clone was constructed by recombining an
attB-attached open reading frame (ORF) fragment with attP
sequences of the Gateway donor vector pDONR201. The ORF sequence
in the entry clone is flanked with attL1 sequence (100 nt) -
spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
translational initiation codon (ATG) and is also flanked with
spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
the ORF. This is an F-type clone that deletes the stop codon for
C-terminal tagged proteins. DNA sequences of the entire ORF and
flanking regions were validated by sequencing. Clone structure of
the ORF and flanking sequences is as follows:
5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
attL sequences are described in lower cases).
Clone information: http://www.HGPD.jp/
This clone was produced in the "Functional Analysis of Protein and
Research Application" project supported by the New Energy and
Industrial Technology Development Organization (NEDO), Japan
FEATURES Location/Qualifiers
source 1..1752
/clone="FLJ08067AAAF"
/db_xref="H-InvDB:HIT000487592"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="Vector: pDONR201"
/organism="Homo sapiens"
CDS 1..>1752
/codon_start=1
/gene="SHC1"
/product="SHC-transforming protein 1"
/protein_id="BAG70193.1"
/transl_table=1
/translation="MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGP
ILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDS
GPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGV
SYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSS
ILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAY
VAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDG
SAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGA
TLPVGQPVGGDPEVRKQMPPPPPCPAGRELFDDPSYVNAQNLDKARQAVGGAGPPNPA
INGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLSRREAEALLQLNGD
FLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLP
IISAGSELCLQQPVERKL"
BASE COUNT 367 a 533 c 524 g 328 t
ORIGIN
1 atggatctcc tgccccccaa gcccaagtac aatccactcc ggaatgagtc tctgtcatcg
61 ctggaggaag gggcttctgg gtccaccccc ccggaggagc tgccttcccc atcagcttca
121 tccctggggc ccatcctgcc tcctctgcct ggggacgata gtcccactac cctgtgctcc
181 ttcttccccc ggatgagcaa cctgaggctg gccaacccgg ctggggggcg cccagggtct
241 aagggggagc caggaagggc agctgatgat ggggagggga tcgtaggggc agccatgcca
301 gactcaggcc ccctacccct cctccaggac atgaacaagc tgagtggagg cggcgggcgc
361 aggactcggg tggaaggggg ccagcttggg ggcgaggagt ggacccgcca cgggagcttt
421 gtcaataagc ccacgcgggg ctggctgcat cccaacgaca aagtcatggg acccggggtt
481 tcctacttgg ttcggtacat gggttgtgtg gaggtcctcc agtcaatgcg tgccctggac
541 ttcaacaccc ggactcaggt caccagggag gccatcagtc tggtgtgtga ggctgtgccg
601 ggtgctaagg gggcgacaag gaggagaaag ccctgtagcc gcccgctcag ctctatcctg
661 gggaggagta acctgaaatt tgctggaatg ccaatcactc tcaccgtctc caccagcagc
721 ctcaacctca tggccgcaga ctgcaaacag atcatcgcca accaccacat gcaatctatc
781 tcatttgcat ccggcgggga tccggacaca gccgagtatg tcgcctatgt tgccaaagac
841 cctgtgaatc agagagcctg ccacattctg gagtgtcccg aagggcttgc ccaggatgtc
901 atcagcacca ttggccaggc cttcgagttg cgcttcaaac aatacctcag gaacccaccc
961 aaactggtca cccctcatga caggatggct ggctttgatg gctcagcatg ggatgaggag
1021 gaggaagagc cacctgacca tcagtactat aatgacttcc cggggaagga accccccttg
1081 gggggggtgg tagacatgag gcttcgggaa ggagccgctc caggggctgc tcgacccact
1141 gcacccaatg cccagacccc cagccacttg ggagctacat tgcctgtagg acagcctgtt
1201 gggggagatc cagaagtccg caaacagatg ccacctccac caccctgtcc agcaggcaga
1261 gagctttttg atgatccctc ctatgtcaac gcccagaacc tagacaaggc ccggcaagca
1321 gtgggtggtg ccgggccccc caatcctgct atcaatggca gtgcaccccg ggacctgttt
1381 gacatgaagc ccttcgaaga tgctcttcgc gtgcctccac ctccccagtc ggtgtccatg
1441 gctgagcagc tccgagggga gccctggttc catgggaagc tgagccggcg ggaggctgag
1501 gcactgctgc agctcaatgg ggacttcctg gtacgggaga gcacgaccac acctggccag
1561 tatgtgctca ctggcttgca gagtgggcag cctaagcatt tgctactggt ggaccctgag
1621 ggtgtggttc ggactaagga tcaccgcttt gaaagtgtca gtcaccttat cagctaccac
1681 atggacaatc acttgcccat catctctgcg ggcagcgaac tgtgtctaca gcaacctgtg
1741 gagcggaaac tg
//