LOCUS       AB451376                1002 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens MAP2K6 mRNA for mitogen-activated protein kinase
            kinase 6, partial cds, clone: FLJ08063AAAF.
ACCESSION   AB451376
VERSION     AB451376.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1002)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..1002
                     /clone="FLJ08063AAAF"
                     /db_xref="H-InvDB:HIT000487589"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>1002
                     /codon_start=1
                     /gene="MAP2K6"
                     /product="mitogen-activated protein kinase kinase 6"
                     /protein_id="BAG70190.1"
                     /transl_table=1
                     /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQ
                     NFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDI
                     SMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAV
                     SIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKP
                     YMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSP
                     QLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
                     "
BASE COUNT          300 a          216 c          241 g          245 t
ORIGIN      
        1 atgtctcagt cgaaaggcaa gaagcgaaac cctggcctta aaattccaaa agaagcattt
       61 gaacaacctc agaccagttc cacaccacct cgagatttag actccaaggc ttgcatttct
      121 attggaaatc agaactttga ggtgaaggca gatgacctgg agcctataat ggaactggga
      181 cgaggtgcgt acggggtggt ggagaagatg cggcacgtgc ccagcgggca gatcatggca
      241 gtgaagcgga tccgagccac agtaaatagc caggaacaga aacggctact gatggatttg
      301 gatatttcca tgaggacggt ggactgtcca ttcactgtca ccttttatgg cgcactgttt
      361 cgggagggtg atgtgtggat ctgcatggag ctcatggata catcactaga taaattctac
      421 aaacaagtta ttgataaagg ccagacaatt ccagaggaca tcttagggaa aatagcagtt
      481 tctattgtaa aagcattaga acatttacat agtaagctgt ctgtcattca cagagacgtc
      541 aagccttcta atgtactcat caatgctctc ggtcaagtga agatgtgcga ttttggaatc
      601 agtggctact tggtggactc tgttgctaaa acaattgatg caggttgcaa accatacatg
      661 gcccctgaaa gaataaaccc agagctcaac cagaagggat acagtgtgaa gtctgacatt
      721 tggagtctgg gcatcacgat gattgagttg gccatccttc gatttcccta tgattcatgg
      781 ggaactccat ttcagcagct caaacaggtg gtagaggagc catcgccaca actcccagca
      841 gacaagttct ctgcagagtt tgttgacttt acctcacagt gcttaaagaa gaattccaaa
      901 gaacggccta catacccaga gctaatgcaa catccatttt tcaccctaca tgaatccaaa
      961 ggaacagatg tggcatcttt tgtaaaactg attcttggag ac
//