LOCUS AB451376 1002 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens MAP2K6 mRNA for mitogen-activated protein kinase kinase 6, partial cds, clone: FLJ08063AAAF. ACCESSION AB451376 VERSION AB451376.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1002) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..1002 /clone="FLJ08063AAAF" /db_xref="H-InvDB:HIT000487589" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>1002 /codon_start=1 /gene="MAP2K6" /product="mitogen-activated protein kinase kinase 6" /protein_id="BAG70190.1" /transl_table=1 /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQ NFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDI SMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAV SIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKP YMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSP QLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD " BASE COUNT 300 a 216 c 241 g 245 t ORIGIN 1 atgtctcagt cgaaaggcaa gaagcgaaac cctggcctta aaattccaaa agaagcattt 61 gaacaacctc agaccagttc cacaccacct cgagatttag actccaaggc ttgcatttct 121 attggaaatc agaactttga ggtgaaggca gatgacctgg agcctataat ggaactggga 181 cgaggtgcgt acggggtggt ggagaagatg cggcacgtgc ccagcgggca gatcatggca 241 gtgaagcgga tccgagccac agtaaatagc caggaacaga aacggctact gatggatttg 301 gatatttcca tgaggacggt ggactgtcca ttcactgtca ccttttatgg cgcactgttt 361 cgggagggtg atgtgtggat ctgcatggag ctcatggata catcactaga taaattctac 421 aaacaagtta ttgataaagg ccagacaatt ccagaggaca tcttagggaa aatagcagtt 481 tctattgtaa aagcattaga acatttacat agtaagctgt ctgtcattca cagagacgtc 541 aagccttcta atgtactcat caatgctctc ggtcaagtga agatgtgcga ttttggaatc 601 agtggctact tggtggactc tgttgctaaa acaattgatg caggttgcaa accatacatg 661 gcccctgaaa gaataaaccc agagctcaac cagaagggat acagtgtgaa gtctgacatt 721 tggagtctgg gcatcacgat gattgagttg gccatccttc gatttcccta tgattcatgg 781 ggaactccat ttcagcagct caaacaggtg gtagaggagc catcgccaca actcccagca 841 gacaagttct ctgcagagtt tgttgacttt acctcacagt gcttaaagaa gaattccaaa 901 gaacggccta catacccaga gctaatgcaa catccatttt tcaccctaca tgaatccaaa 961 ggaacagatg tggcatcttt tgtaaaactg attcttggag ac //