LOCUS AB451367 1440 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens AKT1 mRNA for v-akt murine thymoma viral oncogene homolog 1, partial cds, clone: FLJ08041AAAF. ACCESSION AB451367 VERSION AB451367.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1440) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..1440 /clone="FLJ08041AAAF" /db_xref="H-InvDB:HIT000487580" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>1440 /codon_start=1 /gene="AKT1" /product="v-akt murine thymoma viral oncogene homolog 1" /protein_id="BAG70181.1" /transl_table=1 /translation="MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQD VDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTA IQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGT FGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQ THDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLK LENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWG LGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRL GGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITIT PPDQDDSMECVDSERRPHFPQFSYSASSTA" BASE COUNT 322 a 422 c 437 g 259 t ORIGIN 1 atgagcgacg tggctattgt gaaggagggt tggctgcaca aacgagggga gtacatcaag 61 acctggcggc cacgctactt cctcctcaag aatgatggca ccttcattgg ctacaaggag 121 cggccgcagg atgtggacca acgtgaggct cccctcaaca acttctctgt ggcgcagtgc 181 cagctgatga agacggagcg gccccggccc aacaccttca tcatccgctg cctgcagtgg 241 accactgtca tcgaacgcac cttccatgtg gagactcctg aggagcggga ggagtggaca 301 accgccatcc agactgtggc tgacggcctc aagaagcagg aggaggagga gatggacttc 361 cggtcgggct cacccagtga caactcaggg gctgaagaga tggaggtgtc cctggccaag 421 cccaagcacc gcgtgaccat gaacgagttt gagtacctga agctgctggg caagggcact 481 ttcggcaagg tgatcctggt gaaggagaag gccacaggcc gctactacgc catgaagatc 541 ctcaagaagg aagtcatcgt ggccaaggac gaggtggccc acacactcac cgagaaccgc 601 gtcctgcaga actccaggca ccccttcctc acagccctga agtactcttt ccagacccac 661 gaccgcctct gctttgtcat ggagtacgcc aacgggggcg agctgttctt ccacctgtcc 721 cgggagcgtg tgttctccga ggaccgggcc cgcttctatg gcgctgagat tgtgtcagcc 781 ctggactacc tgcactcgga gaagaacgtg gtgtaccggg acctcaagct ggagaacctc 841 atgctggaca aggacgggca cattaagatc acagacttcg ggctgtgcaa ggaggggatc 901 aaggacggtg ccaccatgaa gaccttttgc ggcacacctg agtacctggc ccccgaggtg 961 ctggaggaca atgactacgg ccgtgcagtg gactggtggg ggctgggcgt ggtcatgtac 1021 gagatgatgt gcggtcgcct gcccttctac aaccaggacc atgagaagct ttttgagctc 1081 atcctcatgg aggagatccg cttcccgcgc acgcttggtc ccgaggccaa gtccttgctt 1141 tcagggctgc tcaagaagga ccccaagcag aggcttggcg ggggctccga ggacgccaag 1201 gagatcatgc agcatcgctt ctttgccggt atcgtgtggc agcacgtgta cgagaagaag 1261 ctcagcccac ccttcaagcc ccaggtcacg tcggagactg acaccaggta ttttgatgag 1321 gagttcacgg cccagatgat caccatcaca ccacctgacc aagatgacag catggagtgt 1381 gtggacagcg agcgcaggcc ccacttcccc cagttctcct actcggccag cagcacggcc //