LOCUS       AB451367                1440 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens AKT1 mRNA for v-akt murine thymoma viral oncogene
            homolog 1, partial cds, clone: FLJ08041AAAF.
ACCESSION   AB451367
VERSION     AB451367.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..1440
                     /clone="FLJ08041AAAF"
                     /db_xref="H-InvDB:HIT000487580"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>1440
                     /codon_start=1
                     /gene="AKT1"
                     /product="v-akt murine thymoma viral oncogene homolog 1"
                     /protein_id="BAG70181.1"
                     /transl_table=1
                     /translation="MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQD
                     VDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTA
                     IQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGT
                     FGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQ
                     THDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLK
                     LENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWG
                     LGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRL
                     GGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITIT
                     PPDQDDSMECVDSERRPHFPQFSYSASSTA"
BASE COUNT          322 a          422 c          437 g          259 t
ORIGIN      
        1 atgagcgacg tggctattgt gaaggagggt tggctgcaca aacgagggga gtacatcaag
       61 acctggcggc cacgctactt cctcctcaag aatgatggca ccttcattgg ctacaaggag
      121 cggccgcagg atgtggacca acgtgaggct cccctcaaca acttctctgt ggcgcagtgc
      181 cagctgatga agacggagcg gccccggccc aacaccttca tcatccgctg cctgcagtgg
      241 accactgtca tcgaacgcac cttccatgtg gagactcctg aggagcggga ggagtggaca
      301 accgccatcc agactgtggc tgacggcctc aagaagcagg aggaggagga gatggacttc
      361 cggtcgggct cacccagtga caactcaggg gctgaagaga tggaggtgtc cctggccaag
      421 cccaagcacc gcgtgaccat gaacgagttt gagtacctga agctgctggg caagggcact
      481 ttcggcaagg tgatcctggt gaaggagaag gccacaggcc gctactacgc catgaagatc
      541 ctcaagaagg aagtcatcgt ggccaaggac gaggtggccc acacactcac cgagaaccgc
      601 gtcctgcaga actccaggca ccccttcctc acagccctga agtactcttt ccagacccac
      661 gaccgcctct gctttgtcat ggagtacgcc aacgggggcg agctgttctt ccacctgtcc
      721 cgggagcgtg tgttctccga ggaccgggcc cgcttctatg gcgctgagat tgtgtcagcc
      781 ctggactacc tgcactcgga gaagaacgtg gtgtaccggg acctcaagct ggagaacctc
      841 atgctggaca aggacgggca cattaagatc acagacttcg ggctgtgcaa ggaggggatc
      901 aaggacggtg ccaccatgaa gaccttttgc ggcacacctg agtacctggc ccccgaggtg
      961 ctggaggaca atgactacgg ccgtgcagtg gactggtggg ggctgggcgt ggtcatgtac
     1021 gagatgatgt gcggtcgcct gcccttctac aaccaggacc atgagaagct ttttgagctc
     1081 atcctcatgg aggagatccg cttcccgcgc acgcttggtc ccgaggccaa gtccttgctt
     1141 tcagggctgc tcaagaagga ccccaagcag aggcttggcg ggggctccga ggacgccaag
     1201 gagatcatgc agcatcgctt ctttgccggt atcgtgtggc agcacgtgta cgagaagaag
     1261 ctcagcccac ccttcaagcc ccaggtcacg tcggagactg acaccaggta ttttgatgag
     1321 gagttcacgg cccagatgat caccatcaca ccacctgacc aagatgacag catggagtgt
     1381 gtggacagcg agcgcaggcc ccacttcccc cagttctcct actcggccag cagcacggcc
//