LOCUS       AB451365                 927 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens PPP2CA mRNA for serine/threonine-protein phosphatase
            2A catalytic subunit alpha isoform, partial cds, clone:
            FLJ08039AAAF.
ACCESSION   AB451365
VERSION     AB451365.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 927)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..927
                     /clone="FLJ08039AAAF"
                     /db_xref="H-InvDB:HIT000487578"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>927
                     /codon_start=1
                     /gene="PPP2CA"
                     /product="serine/threonine-protein phosphatase 2A
                     catalytic subunit alpha isoform"
                     /protein_id="BAG70179.1"
                     /transl_table=1
                     /translation="MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESN
                     VQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVA
                     LKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD
                     GQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGY
                     TFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM
                     ELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL"
BASE COUNT          250 a          191 c          226 g          260 t
ORIGIN      
        1 atggacgaga aggtgttcac caaggagctg gaccagtgga tcgagcagct gaacgagtgc
       61 aagcagctgt ccgagtccca ggtcaagagc ctctgcgaga aggctaaaga aatcctgaca
      121 aaagaatcca acgtgcaaga ggttcgatgt ccagttactg tctgtggaga tgtgcatggg
      181 caatttcatg atctcatgga actgtttaga attggtggca aatcaccaga tacaaattac
      241 ttgtttatgg gagattatgt tgacagagga tattattcag ttgaaacagt tacactgctt
      301 gtagctctta aggttcgtta ccgtgaacgc atcaccattc ttcgagggaa tcatgagagc
      361 agacagatca cacaagttta tggtttctat gatgaatgtt taagaaaata tggaaatgca
      421 aatgtttgga aatattttac agatcttttt gactatcttc ctctcactgc cttggtggat
      481 gggcagatct tctgtctaca tggtggtctc tcgccatcta tagatacact ggatcatatc
      541 agagcacttg atcgcctaca agaagttccc catgagggtc caatgtgtga cttgctgtgg
      601 tcagatccag atgaccgtgg tggttggggt atatctcctc gaggagctgg ttacaccttt
      661 gggcaagata tttctgagac atttaatcat gccaatggcc tcacgttggt gtctagagct
      721 caccagctag tgatggaggg atataactgg tgccatgacc ggaatgtagt aacgattttc
      781 agtgctccaa actattgtta tcgttgtggt aaccaagctg caatcatgga acttgacgat
      841 actctaaaat actctttctt gcagtttgac ccagcacctc gtagaggcga gccacatgta
      901 actcgtcgta ccccagacta cttcctg
//