LOCUS AB451365 927 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens PPP2CA mRNA for serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, partial cds, clone: FLJ08039AAAF. ACCESSION AB451365 VERSION AB451365.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 927) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..927 /clone="FLJ08039AAAF" /db_xref="H-InvDB:HIT000487578" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>927 /codon_start=1 /gene="PPP2CA" /product="serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" /protein_id="BAG70179.1" /transl_table=1 /translation="MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESN VQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVA LKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD GQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGY TFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIM ELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL" BASE COUNT 250 a 191 c 226 g 260 t ORIGIN 1 atggacgaga aggtgttcac caaggagctg gaccagtgga tcgagcagct gaacgagtgc 61 aagcagctgt ccgagtccca ggtcaagagc ctctgcgaga aggctaaaga aatcctgaca 121 aaagaatcca acgtgcaaga ggttcgatgt ccagttactg tctgtggaga tgtgcatggg 181 caatttcatg atctcatgga actgtttaga attggtggca aatcaccaga tacaaattac 241 ttgtttatgg gagattatgt tgacagagga tattattcag ttgaaacagt tacactgctt 301 gtagctctta aggttcgtta ccgtgaacgc atcaccattc ttcgagggaa tcatgagagc 361 agacagatca cacaagttta tggtttctat gatgaatgtt taagaaaata tggaaatgca 421 aatgtttgga aatattttac agatcttttt gactatcttc ctctcactgc cttggtggat 481 gggcagatct tctgtctaca tggtggtctc tcgccatcta tagatacact ggatcatatc 541 agagcacttg atcgcctaca agaagttccc catgagggtc caatgtgtga cttgctgtgg 601 tcagatccag atgaccgtgg tggttggggt atatctcctc gaggagctgg ttacaccttt 661 gggcaagata tttctgagac atttaatcat gccaatggcc tcacgttggt gtctagagct 721 caccagctag tgatggaggg atataactgg tgccatgacc ggaatgtagt aacgattttc 781 agtgctccaa actattgtta tcgttgtggt aaccaagctg caatcatgga acttgacgat 841 actctaaaat actctttctt gcagtttgac ccagcacctc gtagaggcga gccacatgta 901 actcgtcgta ccccagacta cttcctg //