LOCUS       AB451363                 576 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens RAC1 mRNA for ras-related C3 botulinum toxin
            substrate 1 isoform Rac1, partial cds, clone: FLJ08036AAAF.
ACCESSION   AB451363
VERSION     AB451363.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 576)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..576
                     /clone="FLJ08036AAAF"
                     /db_xref="H-InvDB:HIT000487576"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>576
                     /codon_start=1
                     /gene="RAC1"
                     /product="ras-related C3 botulinum toxin substrate 1
                     isoform Rac1"
                     /protein_id="BAG70177.1"
                     /transl_table=1
                     /translation="MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANV
                     MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVR
                     HHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSAL
                     TQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL"
BASE COUNT          157 a          133 c          145 g          141 t
ORIGIN      
        1 atgcaggcca tcaagtgtgt ggtggtggga gacggagctg taggtaaaac ttgcctactg
       61 atcagttaca caaccaatgc atttcctgga gaatatatcc ctactgtctt tgacaattat
      121 tctgccaatg ttatggtaga tggaaaaccg gtgaatctgg gcttatggga tacagctgga
      181 caagaagatt atgacagatt acgcccccta tcctatccgc aaacagatgt gttcttaatt
      241 tgcttttccc ttgtgagtcc tgcatcattt gaaaatgtcc gtgcaaagtg gtatcctgag
      301 gtgcggcacc actgtcccaa cactcccatc atcctagtgg gaactaaact tgatcttagg
      361 gatgataaag acacgatcga gaaactgaag gagaagaagc tgactcccat cacctatccg
      421 cagggtctag ccatggctaa ggagattggt gctgtaaaat acctggagtg ctcggcgctc
      481 acacagcgag gcctcaagac agtgtttgac gaagcgatcc gagcagtcct ctgcccgcct
      541 cccgtgaaga agaggaagag aaaatgcctg ctgttg
//