LOCUS       AB451326                1941 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens AKAP8L mRNA for A-kinase anchor protein 8-like,
            complete cds, clone: FLJ10732SAAN.
ACCESSION   AB451326
VERSION     AB451326.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1941)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with a
            spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the
            ORF. This is an N-type clone which has an intrinsic stop codon at
            the end of ORF. DNA sequences of the entire ORF and flanking
            regions were validated by sequencing. Clone structure of the ORF
            and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa
            caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL
            sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..1941
                     /clone="FLJ10732SAAN"
                     /db_xref="H-InvDB:HIT000487539"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..1941
                     /codon_start=1
                     /gene="AKAP8L"
                     /product="A-kinase anchor protein 8-like"
                     /protein_id="BAG70140.1"
                     /transl_table=1
                     /translation="MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEG
                     YGYGYGYGQDNTTNYGYGMATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMV
                     PHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLYRSGYDYSELDPEMEMAYEGQ
                     YDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRL
                     PSLFSQNIIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKK
                     KRKQGGSPDEPDSKATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEE
                     GKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCS
                     LCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTADFLQEYVTNKTKKTEELRKTV
                     EDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHN
                     RNRRLMMEQSKKSSLMVARSILNNKLISKKLERYLKGENPFTDSPEEEKEQEEAEGGA
                     LDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAVSPPPPPPPEEEEEGAVPLLGGALQ
                     RQIRGIPGLDVEDDEEGGGGAP"
BASE COUNT          483 a          522 c          627 g          309 t
ORIGIN      
        1 atgagctaca caggctttgt ccagggatct gaaaccactt tgcagtcgac atactcggat
       61 accagcgctc agcccacctg tgattatgga tatggaactt ggaactctgg gacaaataga
      121 ggctacgagg gctatggcta tggctatggc tatggccagg ataacaccac caactatggg
      181 tatggtatgg ccacttcaca ctcttgggaa atgcctagct ctgacacaaa tgcaaacact
      241 agtgcctcgg gtagcgccag tgccgattcc gttttatcca gaattaacca gcgcttagat
      301 atggtgccgc atttggagac agacatgatg caaggaggcg tgtacggctc aggtggagaa
      361 aggtatgact cttatgagtc ctgcgactcg agggccgtcc tgagtgagcg cgacctgtac
      421 cggtcaggct atgactacag cgagcttgac cctgagatgg aaatggccta tgagggccaa
      481 tacgatgcct accgcgacca gttccgcatg cgtggcaacg acaccttcgg tcccagggca
      541 cagggctggg cccgggatgc ccggagcggc cggccaatgg cctcaggcta tgggcgcatg
      601 tgggaagacc ccatgggggc ccggggccag tgcatgtctg gtgcctctcg gctgccctcc
      661 ctcttctccc agaacatcat ccccgagtac ggcatgttcc agggcatgcg aggtgggggc
      721 gccttcccgg gcggctcccg ctttggtttc gggtttggca atggcatgaa gcagatgagg
      781 cggacctgga agacctggac cacagccgac ttccgaacca agaagaagaa gagaaagcag
      841 ggcggcagtc ctgatgagcc agatagcaaa gccacccgca cggactgctc ggacaacagc
      901 gactcagaca atgatgaggg caccgagggg gaagccacag agggccttga aggcaccgag
      961 gctgtggaga agggctccag agtggacgga gaggatgagg agggaaaaga ggatgggaga
     1021 gaagaaggca aagaggatcc agagaagggg gccctaacca cccaggatga aaatggccag
     1081 accaagcgca agttgcaggc aggcaagaag agtcaggaca agcagaaaaa gcggcagcga
     1141 gaccgcatgg tggaaaggat ccagtttgtg tgttctctgt gcaaataccg gaccttctat
     1201 gaggacgaga tggccagcca tcttgacagc aagttccaca aggaacactt taagtacgta
     1261 ggcaccaagc tccctaagca gacggctgac tttctgcagg agtacgtcac taacaagacc
     1321 aagaagacag aggagctccg aaaaaccgtg gaggaccttg atggcctcat ccagcaaatc
     1381 tacagagacc aggatctgac ccaggaaatt gccatggagc attttgtgaa gaaggtggag
     1441 gcagcccatt gtgcagcctg cgacctcttc attcccatgc agtttgggat catccagaag
     1501 catctgaaga ccatggatca caaccggaac cgcaggctca tgatggagca gtccaagaag
     1561 tcctccctca tggtggcccg cagtattctc aacaacaagc tcatcagcaa gaagctggag
     1621 cgctacctga agggcgagaa ccctttcacc gacagccccg aggaggagaa ggagcaggag
     1681 gaggctgagg gcggtgccct ggacgagggg gcgcagggcg aagcggcagg gatctcggag
     1741 ggcgcagagg gcgtgccggc gcagcctccc gtgcccccag agccagcccc cggggccgtg
     1801 tcgccgccac cgccgccgcc cccagaggag gaggaggagg gcgccgtgcc cttgctggga
     1861 ggggcgctgc aacgccagat ccgcggcatc ccgggcctcg acgtggagga cgacgaggag
     1921 ggcggcgggg gcgccccgta a
//