LOCUS AB451326 1941 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens AKAP8L mRNA for A-kinase anchor protein 8-like, complete cds, clone: FLJ10732SAAN. ACCESSION AB451326 VERSION AB451326.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1941) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with a spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the ORF. This is an N-type clone which has an intrinsic stop codon at the end of ORF. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..1941 /clone="FLJ10732SAAN" /db_xref="H-InvDB:HIT000487539" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..1941 /codon_start=1 /gene="AKAP8L" /product="A-kinase anchor protein 8-like" /protein_id="BAG70140.1" /transl_table=1 /translation="MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEG YGYGYGYGQDNTTNYGYGMATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMV PHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLYRSGYDYSELDPEMEMAYEGQ YDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRL PSLFSQNIIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKK KRKQGGSPDEPDSKATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEE GKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCS LCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTADFLQEYVTNKTKKTEELRKTV EDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHN RNRRLMMEQSKKSSLMVARSILNNKLISKKLERYLKGENPFTDSPEEEKEQEEAEGGA LDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAVSPPPPPPPEEEEEGAVPLLGGALQ RQIRGIPGLDVEDDEEGGGGAP" BASE COUNT 483 a 522 c 627 g 309 t ORIGIN 1 atgagctaca caggctttgt ccagggatct gaaaccactt tgcagtcgac atactcggat 61 accagcgctc agcccacctg tgattatgga tatggaactt ggaactctgg gacaaataga 121 ggctacgagg gctatggcta tggctatggc tatggccagg ataacaccac caactatggg 181 tatggtatgg ccacttcaca ctcttgggaa atgcctagct ctgacacaaa tgcaaacact 241 agtgcctcgg gtagcgccag tgccgattcc gttttatcca gaattaacca gcgcttagat 301 atggtgccgc atttggagac agacatgatg caaggaggcg tgtacggctc aggtggagaa 361 aggtatgact cttatgagtc ctgcgactcg agggccgtcc tgagtgagcg cgacctgtac 421 cggtcaggct atgactacag cgagcttgac cctgagatgg aaatggccta tgagggccaa 481 tacgatgcct accgcgacca gttccgcatg cgtggcaacg acaccttcgg tcccagggca 541 cagggctggg cccgggatgc ccggagcggc cggccaatgg cctcaggcta tgggcgcatg 601 tgggaagacc ccatgggggc ccggggccag tgcatgtctg gtgcctctcg gctgccctcc 661 ctcttctccc agaacatcat ccccgagtac ggcatgttcc agggcatgcg aggtgggggc 721 gccttcccgg gcggctcccg ctttggtttc gggtttggca atggcatgaa gcagatgagg 781 cggacctgga agacctggac cacagccgac ttccgaacca agaagaagaa gagaaagcag 841 ggcggcagtc ctgatgagcc agatagcaaa gccacccgca cggactgctc ggacaacagc 901 gactcagaca atgatgaggg caccgagggg gaagccacag agggccttga aggcaccgag 961 gctgtggaga agggctccag agtggacgga gaggatgagg agggaaaaga ggatgggaga 1021 gaagaaggca aagaggatcc agagaagggg gccctaacca cccaggatga aaatggccag 1081 accaagcgca agttgcaggc aggcaagaag agtcaggaca agcagaaaaa gcggcagcga 1141 gaccgcatgg tggaaaggat ccagtttgtg tgttctctgt gcaaataccg gaccttctat 1201 gaggacgaga tggccagcca tcttgacagc aagttccaca aggaacactt taagtacgta 1261 ggcaccaagc tccctaagca gacggctgac tttctgcagg agtacgtcac taacaagacc 1321 aagaagacag aggagctccg aaaaaccgtg gaggaccttg atggcctcat ccagcaaatc 1381 tacagagacc aggatctgac ccaggaaatt gccatggagc attttgtgaa gaaggtggag 1441 gcagcccatt gtgcagcctg cgacctcttc attcccatgc agtttgggat catccagaag 1501 catctgaaga ccatggatca caaccggaac cgcaggctca tgatggagca gtccaagaag 1561 tcctccctca tggtggcccg cagtattctc aacaacaagc tcatcagcaa gaagctggag 1621 cgctacctga agggcgagaa ccctttcacc gacagccccg aggaggagaa ggagcaggag 1681 gaggctgagg gcggtgccct ggacgagggg gcgcagggcg aagcggcagg gatctcggag 1741 ggcgcagagg gcgtgccggc gcagcctccc gtgcccccag agccagcccc cggggccgtg 1801 tcgccgccac cgccgccgcc cccagaggag gaggaggagg gcgccgtgcc cttgctggga 1861 ggggcgctgc aacgccagat ccgcggcatc ccgggcctcg acgtggagga cgacgaggag 1921 ggcggcgggg gcgccccgta a //