LOCUS       AB451323                 564 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens IFNB1 mRNA for interferon beta precursor, complete
            cds, clone: FLJ08204AAAN.
ACCESSION   AB451323
VERSION     AB451323.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 564)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with a
            spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the
            ORF. This is an N-type clone which has an intrinsic stop codon at
            the end of ORF. DNA sequences of the entire ORF and flanking
            regions were validated by sequencing. Clone structure of the ORF
            and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa
            caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL
            sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..564
                     /clone="FLJ08204AAAN"
                     /db_xref="H-InvDB:HIT000487536"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..564
                     /codon_start=1
                     /gene="IFNB1"
                     /product="interferon beta precursor"
                     /protein_id="BAG70137.1"
                     /transl_table=1
                     /translation="MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQ
                     LNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNE
                     TIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYS
                     HCAWTIVRVEILRNFYFINRLTGYLRN"
BASE COUNT          171 a          126 c          124 g          143 t
ORIGIN      
        1 atgaccaaca agtgtctcct ccaaattgct ctcctgttgt gcttctccac tacagctctt
       61 tccatgagct acaacttgct tggattccta caaagaagca gcaattttca gtgtcagaag
      121 ctcctgtggc aattgaatgg gaggcttgaa tattgcctca aggacaggat gaactttgac
      181 atccctgagg agattaagca gctgcagcag ttccagaagg aggacgccgc attgaccatc
      241 tatgagatgc tccagaacat ctttgctatt ttcagacaag attcatctag cactggctgg
      301 aatgagacta ttgttgagaa cctcctggct aatgtctatc atcagataaa ccatctgaag
      361 acagtcctgg aagaaaaact ggagaaagaa gatttcacca ggggaaaact catgagcagt
      421 ctgcacctga aaagatatta tgggaggatt ctgcattacc tgaaggccaa ggagtacagt
      481 cactgtgcct ggaccatagt cagagtggaa atcctaagga acttttactt cattaacaga
      541 cttacaggtt acctccgaaa ctaa
//