LOCUS AB451323 564 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens IFNB1 mRNA for interferon beta precursor, complete cds, clone: FLJ08204AAAN. ACCESSION AB451323 VERSION AB451323.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 564) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with a spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the ORF. This is an N-type clone which has an intrinsic stop codon at the end of ORF. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..564 /clone="FLJ08204AAAN" /db_xref="H-InvDB:HIT000487536" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..564 /codon_start=1 /gene="IFNB1" /product="interferon beta precursor" /protein_id="BAG70137.1" /transl_table=1 /translation="MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQ LNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNE TIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYS HCAWTIVRVEILRNFYFINRLTGYLRN" BASE COUNT 171 a 126 c 124 g 143 t ORIGIN 1 atgaccaaca agtgtctcct ccaaattgct ctcctgttgt gcttctccac tacagctctt 61 tccatgagct acaacttgct tggattccta caaagaagca gcaattttca gtgtcagaag 121 ctcctgtggc aattgaatgg gaggcttgaa tattgcctca aggacaggat gaactttgac 181 atccctgagg agattaagca gctgcagcag ttccagaagg aggacgccgc attgaccatc 241 tatgagatgc tccagaacat ctttgctatt ttcagacaag attcatctag cactggctgg 301 aatgagacta ttgttgagaa cctcctggct aatgtctatc atcagataaa ccatctgaag 361 acagtcctgg aagaaaaact ggagaaagaa gatttcacca ggggaaaact catgagcagt 421 ctgcacctga aaagatatta tgggaggatt ctgcattacc tgaaggccaa ggagtacagt 481 cactgtgcct ggaccatagt cagagtggaa atcctaagga acttttactt cattaacaga 541 cttacaggtt acctccgaaa ctaa //