LOCUS       AB451322                 576 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens VEGFA mRNA for vascular endothelial growth factor
            isoform VEGF165, complete cds, clone: FLJ08203AAAN.
ACCESSION   AB451322
VERSION     AB451322.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 576)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with a
            spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the
            ORF. This is an N-type clone which has an intrinsic stop codon at
            the end of ORF. DNA sequences of the entire ORF and flanking
            regions were validated by sequencing. Clone structure of the ORF
            and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa
            caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL
            sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..576
                     /clone="FLJ08203AAAN"
                     /db_xref="H-InvDB:HIT000487535"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..576
                     /codon_start=1
                     /gene="VEGFA"
                     /product="vascular endothelial growth factor isoform
                     VEGF165"
                     /protein_id="BAG70136.1"
                     /transl_table=1
                     /translation="MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFM
                     DVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNI
                     TMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQT
                     CKCSCKNTDSRCKARQLELNERTCRCDKPRR"
BASE COUNT          158 a          143 c          157 g          118 t
ORIGIN      
        1 atgaactttc tgctgtcttg ggtgcattgg agccttgcct tgctgctcta cctccaccat
       61 gccaagtggt cccaggctgc acccatggca gaaggaggag ggcagaatca tcacgaagtg
      121 gtgaagttca tggatgtcta tcagcgcagc tactgccatc caatcgagac cctggtggac
      181 atcttccagg agtaccctga tgagatcgag tacatcttca agccatcctg tgtgcccctg
      241 atgcgatgcg ggggctgctg caatgacgag ggcctggagt gtgtgcccac tgaggagtcc
      301 aacatcacca tgcagattat gcggatcaaa cctcaccaag gccagcacat aggagagatg
      361 agcttcctac agcacaacaa atgtgaatgc agaccaaaga aagatagagc aagacaagaa
      421 aatccctgtg ggccttgctc agagcggaga aagcatttgt ttgtacaaga tccgcagacg
      481 tgtaaatgtt cctgcaaaaa cacagactcg cgttgcaagg cgaggcagct tgagttaaac
      541 gaacgtactt gcagatgtga caagccgagg cggtaa
//