LOCUS AB451315 606 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens ARHGDIB mRNA for Rho GDP-dissociation inhibitor 2, complete cds, clone: FLJ08179AAAN. ACCESSION AB451315 VERSION AB451315.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 606) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with a spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the ORF. This is an N-type clone which has an intrinsic stop codon at the end of ORF. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..606 /clone="FLJ08179AAAN" /db_xref="H-InvDB:HIT000487528" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..606 /codon_start=1 /gene="ARHGDIB" /product="Rho GDP-dissociation inhibitor 2" /protein_id="BAG70129.1" /transl_table=1 /translation="MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDES LIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLK EGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVE EAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE" BASE COUNT 186 a 136 c 165 g 119 t ORIGIN 1 atgactgaaa aagccccaga gccacatgtg gaggaggatg acgatgatga gctggacagc 61 aagctcaatt ataagcctcc accacagaag tccctgaaag agctgcagga aatggacaaa 121 gatgatgaga gtctaattaa gtacaagaaa acgctgctgg gagatggtcc tgtggtgaca 181 gatccgaaag cccccaatgt cgttgtcacc cggctcaccc tggtttgtga gagtgccccg 241 ggaccaatca ccatggacct tactggagat ctggaagccc tcaaaaagga aaccattgtg 301 ttaaaggaag gttctgaata tagagtcaaa attcacttca aagtgaacag ggatattgtg 361 tcaggcctga aatacgttca gcacacctac aggactgggg tgaaagtgga taaagcaaca 421 tttatggttg gcagctatgg acctcggcct gaggagtatg agttcctcac tccagttgag 481 gaggctccca agggcatgct ggcgcgaggc acgtaccaca acaagtcctt cttcaccgac 541 gatgacaagc aagaccacct cagctgggag tggaacctgt cgattaagaa ggagtggaca 601 gaataa //