LOCUS       AB451315                 606 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens ARHGDIB mRNA for Rho GDP-dissociation inhibitor 2,
            complete cds, clone: FLJ08179AAAN.
ACCESSION   AB451315
VERSION     AB451315.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 606)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with a
            spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the
            ORF. This is an N-type clone which has an intrinsic stop codon at
            the end of ORF. DNA sequences of the entire ORF and flanking
            regions were validated by sequencing. Clone structure of the ORF
            and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa
            caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL
            sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..606
                     /clone="FLJ08179AAAN"
                     /db_xref="H-InvDB:HIT000487528"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..606
                     /codon_start=1
                     /gene="ARHGDIB"
                     /product="Rho GDP-dissociation inhibitor 2"
                     /protein_id="BAG70129.1"
                     /transl_table=1
                     /translation="MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDES
                     LIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLK
                     EGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVE
                     EAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE"
BASE COUNT          186 a          136 c          165 g          119 t
ORIGIN      
        1 atgactgaaa aagccccaga gccacatgtg gaggaggatg acgatgatga gctggacagc
       61 aagctcaatt ataagcctcc accacagaag tccctgaaag agctgcagga aatggacaaa
      121 gatgatgaga gtctaattaa gtacaagaaa acgctgctgg gagatggtcc tgtggtgaca
      181 gatccgaaag cccccaatgt cgttgtcacc cggctcaccc tggtttgtga gagtgccccg
      241 ggaccaatca ccatggacct tactggagat ctggaagccc tcaaaaagga aaccattgtg
      301 ttaaaggaag gttctgaata tagagtcaaa attcacttca aagtgaacag ggatattgtg
      361 tcaggcctga aatacgttca gcacacctac aggactgggg tgaaagtgga taaagcaaca
      421 tttatggttg gcagctatgg acctcggcct gaggagtatg agttcctcac tccagttgag
      481 gaggctccca agggcatgct ggcgcgaggc acgtaccaca acaagtcctt cttcaccgac
      541 gatgacaagc aagaccacct cagctgggag tggaacctgt cgattaagaa ggagtggaca
      601 gaataa
//