LOCUS AB451273 246 bp mRNA linear HUM 02-SEP-2008
DEFINITION Homo sapiens AKAP7 mRNA for A-kinase anchor protein 7 isoform
alpha, complete cds, clone: FLJ08101AAAN.
ACCESSION AB451273
VERSION AB451273.1
KEYWORDS Gateway cloning system.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 246)
AUTHORS Kawamura,Y., Nomura,N. and Goshima,N.
TITLE Direct Submission
JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
Contact:Naoki Goshima
Biomedicinal Information Research Center (BIRC), National
Institute of Advanced Industrial Science and Technology (AIST);
2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE 2
AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
Imai,J.-I., Watanabe,S. and Nomura,N.
TITLE Human Protein Factory: an infrastructure to convert the human
transcriptome into the in vitro-expressed human proteome of
versatile utility
JOURNAL Unpublished (2008)
COMMENT This human Gateway entry clone was constructed by recombining an
attB-attached open reading frame (ORF) fragment with attP
sequences of the Gateway donor vector pDONR201. The ORF sequence
in the entry clone is flanked with attL1 sequence (100 nt) -
spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
translational initiation codon (ATG) and is also flanked with a
spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the
ORF. This is an N-type clone which has an intrinsic stop codon at
the end of ORF. DNA sequences of the entire ORF and flanking
regions were validated by sequencing. Clone structure of the ORF
and flanking sequences is as follows:
5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa
caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL
sequences are described in lower cases).
Clone information: http://www.HGPD.jp/
This clone was produced in the "Functional Analysis of Protein and
Research Application" project supported by the New Energy and
Industrial Technology Development Organization (NEDO), Japan
FEATURES Location/Qualifiers
source 1..246
/clone="FLJ08101AAAN"
/db_xref="H-InvDB:HIT000487486"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="Vector: pDONR201"
/organism="Homo sapiens"
CDS 1..246
/codon_start=1
/gene="AKAP7"
/product="A-kinase anchor protein 7 isoform alpha"
/protein_id="BAG70087.1"
/transl_table=1
/translation="MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKA
VQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK"
BASE COUNT 85 a 45 c 76 g 40 t
ORIGIN
1 atgggccagc tttgctgctt tcctttctca agagatgaag gaaaaatcag tgaaaagaac
61 ggaggggagc ccgatgacgc tgaactagta aggctcagta agaggctggt ggagaacgcg
121 gtgctcaagg ctgtccagca gtatctggag gaaacacaga ataaaaacaa gccgggggag
181 gggagctctg tgaaaaccga agcagctgat cagaatggca atgacaatga gaacaacagg
241 aaataa
//