LOCUS AB306186 375 bp mRNA linear HUM 06-FEB-2008 DEFINITION Homo sapiens mRNA for T cell receptor beta variable 24, partial cds, clone: un 120. ACCESSION AB306186 VERSION AB306186.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 375) AUTHORS Ozawa,T., Tajiri,K., Kishi,H. and Muraguchi,A. TITLE Direct Submission JOURNAL Submitted (29-MAY-2007) to the DDBJ/EMBL/GenBank databases. Contact:Hiroyuki Kishi University of Toyama, Department of Immunology, Graduate School of Medicine and Pharmaceutical Sciences; 2630 Sugitani, Toyama, Toyama 930-0194, Japan REFERENCE 2 AUTHORS Ozawa,T., Tajiri,K., Kishi,H. and Muraguchi,A. TITLE Comprehensive analysis of the functional TCR repertoire at the single-cell level JOURNAL Biochem. Biophys. Res. Commun. 367, 820-825 (2008) COMMENT FEATURES Location/Qualifiers source 1..375 /clone="un 120" /db_xref="H-InvDB:HIT000409684" /db_xref="taxon:9606" /mol_type="mRNA" /note="unstimulated CD4 T cell" /organism="Homo sapiens" CDS <1..>375 /codon_start=2 /product="T cell receptor beta variable 24" /protein_id="BAF94879.1" /transl_table=1 /translation="GNTSILPFHAMASLLFFCGAFYLLGTGSMDADVTQTPTNRITKT GKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAK FSLSLESAIPNQTALYFCATSD" BASE COUNT 96 a 97 c 83 g 99 t ORIGIN 1 tggaaacacc tccatcctgc cttttcatgc catggcctcc ctgctcttct tctgtggggc 61 cttttatctc ctgggaacag ggtccatgga tgctgatgtt acccagaccc caacgaatag 121 gatcacaaag acaggaaaga ggattatgct ggaatgttct cagactaagg gtcatgatag 181 aatgtactgg tatcgacaag acccaggact gggcctacgg ttgatctatt actcctttga 241 tgtcaaagat ataaacaaag gagagatctc tgatggatac agtgtctctc gacaggcaca 301 ggctaaattc tccctgtccc tagagtctgc catccccaac cagacagctc tttacttctg 361 tgccaccagt gattt //