LOCUS       AB306186                 375 bp    mRNA    linear   HUM 06-FEB-2008
DEFINITION  Homo sapiens mRNA for T cell receptor beta variable 24, partial
            cds, clone: un 120.
ACCESSION   AB306186
VERSION     AB306186.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 375)
  AUTHORS   Ozawa,T., Tajiri,K., Kishi,H. and Muraguchi,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAY-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Hiroyuki Kishi
            University of Toyama, Department of Immunology, Graduate School of
            Medicine and Pharmaceutical Sciences; 2630 Sugitani, Toyama,
            Toyama 930-0194, Japan
REFERENCE   2
  AUTHORS   Ozawa,T., Tajiri,K., Kishi,H. and Muraguchi,A.
  TITLE     Comprehensive analysis of the functional TCR repertoire at the
            single-cell level
  JOURNAL   Biochem. Biophys. Res. Commun. 367, 820-825 (2008)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..375
                     /clone="un 120"
                     /db_xref="H-InvDB:HIT000409684"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="unstimulated CD4 T cell"
                     /organism="Homo sapiens"
     CDS             <1..>375
                     /codon_start=2
                     /product="T cell receptor beta variable 24"
                     /protein_id="BAF94879.1"
                     /transl_table=1
                     /translation="GNTSILPFHAMASLLFFCGAFYLLGTGSMDADVTQTPTNRITKT
                     GKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAK
                     FSLSLESAIPNQTALYFCATSD"
BASE COUNT           96 a           97 c           83 g           99 t
ORIGIN      
        1 tggaaacacc tccatcctgc cttttcatgc catggcctcc ctgctcttct tctgtggggc
       61 cttttatctc ctgggaacag ggtccatgga tgctgatgtt acccagaccc caacgaatag
      121 gatcacaaag acaggaaaga ggattatgct ggaatgttct cagactaagg gtcatgatag
      181 aatgtactgg tatcgacaag acccaggact gggcctacgg ttgatctatt actcctttga
      241 tgtcaaagat ataaacaaag gagagatctc tgatggatac agtgtctctc gacaggcaca
      301 ggctaaattc tccctgtccc tagagtctgc catccccaac cagacagctc tttacttctg
      361 tgccaccagt gattt
//