LOCUS AB305856 477 bp mRNA linear HUM 06-FEB-2008 DEFINITION Homo sapiens mRNA for T cell receptor beta variable 28, partial cds, clone: SEB 137. ACCESSION AB305856 VERSION AB305856.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 477) AUTHORS Ozawa,T., Tajiri,K., Kishi,H. and Muraguchi,A. TITLE Direct Submission JOURNAL Submitted (29-MAY-2007) to the DDBJ/EMBL/GenBank databases. Contact:Hiroyuki Kishi University of Toyama, Department of Immunology, Graduate School of Medicine and Pharmaceutical Sciences; 2630 Sugitani, Toyama, Toyama 930-0194, Japan REFERENCE 2 AUTHORS Ozawa,T., Tajiri,K., Kishi,H. and Muraguchi,A. TITLE Comprehensive analysis of the functional TCR repertoire at the single-cell level JOURNAL Biochem. Biophys. Res. Commun. 367, 820-825 (2008) COMMENT FEATURES Location/Qualifiers source 1..477 /clone="SEB 137" /db_xref="H-InvDB:HIT000409354" /db_xref="taxon:9606" /mol_type="mRNA" /note="SEB-stimulated CD4 T cell" /organism="Homo sapiens" CDS <1..>477 /codon_start=3 /note="with constant region" /product="T cell receptor beta variable 28" /protein_id="BAF94549.1" /transl_table=1 /translation="ACFKAAMGIRLLCRVAFCFLAVGLVDVKVTQSSRYLVKRTGEKV FLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLI LESASTNQTSMYLCASRQDTEAGGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEA" BASE COUNT 124 a 100 c 137 g 116 t ORIGIN 1 tggcttgctt caaagcagcc atgggaatca ggctcctctg tcgtgtggcc ttttgtttcc 61 tggctgtagg cctcgtagat gtgaaagtaa cccagagctc gagatatcta gtcaaaagga 121 cgggagagaa agtttttctg gaatgtgtcc aggatatgga ccatgaaaat atgttctggt 181 atcgacaaga cccaggtctg gggctacggc tgatctattt ctcatatgat gttaaaatga 241 aagaaaaagg agatattcct gaggggtaca gtgtctctag agagaagaag gagcgcttct 301 ccctgattct ggagtccgcc agcaccaacc agacatctat gtacctctgt gccagcaggc 361 aagatacaga ggcagggggg gagctgtttt ttggagaagg ctctaggctg accgtactgg 421 aggacctgaa aaacgtgttc ccacccgagg tcgctgtgtt tgagccatca gaagcag //