LOCUS       AB305856                 477 bp    mRNA    linear   HUM 06-FEB-2008
DEFINITION  Homo sapiens mRNA for T cell receptor beta variable 28, partial
            cds, clone: SEB 137.
ACCESSION   AB305856
VERSION     AB305856.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 477)
  AUTHORS   Ozawa,T., Tajiri,K., Kishi,H. and Muraguchi,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAY-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Hiroyuki Kishi
            University of Toyama, Department of Immunology, Graduate School of
            Medicine and Pharmaceutical Sciences; 2630 Sugitani, Toyama,
            Toyama 930-0194, Japan
REFERENCE   2
  AUTHORS   Ozawa,T., Tajiri,K., Kishi,H. and Muraguchi,A.
  TITLE     Comprehensive analysis of the functional TCR repertoire at the
            single-cell level
  JOURNAL   Biochem. Biophys. Res. Commun. 367, 820-825 (2008)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..477
                     /clone="SEB 137"
                     /db_xref="H-InvDB:HIT000409354"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="SEB-stimulated CD4 T cell"
                     /organism="Homo sapiens"
     CDS             <1..>477
                     /codon_start=3
                     /note="with constant region"
                     /product="T cell receptor beta variable 28"
                     /protein_id="BAF94549.1"
                     /transl_table=1
                     /translation="ACFKAAMGIRLLCRVAFCFLAVGLVDVKVTQSSRYLVKRTGEKV
                     FLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLI
                     LESASTNQTSMYLCASRQDTEAGGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEA"
BASE COUNT          124 a          100 c          137 g          116 t
ORIGIN      
        1 tggcttgctt caaagcagcc atgggaatca ggctcctctg tcgtgtggcc ttttgtttcc
       61 tggctgtagg cctcgtagat gtgaaagtaa cccagagctc gagatatcta gtcaaaagga
      121 cgggagagaa agtttttctg gaatgtgtcc aggatatgga ccatgaaaat atgttctggt
      181 atcgacaaga cccaggtctg gggctacggc tgatctattt ctcatatgat gttaaaatga
      241 aagaaaaagg agatattcct gaggggtaca gtgtctctag agagaagaag gagcgcttct
      301 ccctgattct ggagtccgcc agcaccaacc agacatctat gtacctctgt gccagcaggc
      361 aagatacaga ggcagggggg gagctgtttt ttggagaagg ctctaggctg accgtactgg
      421 aggacctgaa aaacgtgttc ccacccgagg tcgctgtgtt tgagccatca gaagcag
//