LOCUS       AB231724                 157 bp    mRNA    linear   HUM 20-OCT-2005
DEFINITION  Homo sapiens mRNA for hypothetical protein, partial cds,
            clone:Hsa11-digit16-11-10-F.
ACCESSION   AB231724
VERSION     AB231724.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 157)
  AUTHORS   Totoki,Y., Yada,T., Sakaki,Y. and Takeda,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Yasushi Totoki
            RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
            Yokohama, Kanagawa 230-0045, Japan
REFERENCE   2
  AUTHORS   Totoki,Y., Yada,T., Sakaki,Y. and Takeda,T.
  TITLE     Identification of novel human genes predicted by combining
            multiple gene-finders
  JOURNAL   Unpublished (2005)
COMMENT     This sequence is a novel human gene predicted by DIGIT 
            (Yada et al. Pac Symp Biocomput, 8;375-387. 2003), 
            an ab-initio gene-finder which finds genes by combining 
            gene predictions from multiple ab initio gene-finders 
            such as FGENESH, GENSCAN and HMMgene. 
            This sequence was verified by RT-PCR.
FEATURES             Location/Qualifiers
     source          1..157
                     /chromosome="11"
                     /clone="Hsa11-digit16-11-10-F"
                     /db_xref="H-InvDB:HIT000329964"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="similar to ref|XM_508722.1| PREDICTED: Pan
                     troglodytes matrix metalloproteinase 1 (LOC451510), mRNA"
                     /organism="Homo sapiens"
     CDS             <1..>157
                     /codon_start=3
                     /product="hypothetical protein"
                     /protein_id="BAE46882.1"
                     /translation="GPGIGGDVHFDNDETRTKDFRSSKHWVVQEDQLLSGYPRDVYSS
                     FVFPERV"
     misc_difference 47
                     /note="compared to genomic sequence"
                     /replace="a"
BASE COUNT           42 a           32 c           46 g           37 t
ORIGIN      
        1 ctggaccagg tatcggagga gatgttcatt ttgataatga tgaaacgagg accaaggatt
       61 tcagaagcag taagcactgg gtcgttcagg aggatcaact gctgagtggc taccccaggg
      121 acgtctacag ctcctttgtc ttccctgaaa gggtgaa
//