LOCUS       AB231703                 217 bp    mRNA    linear   HUM 20-OCT-2005
DEFINITION  Homo sapiens mRNA for hypothetical protein, partial cds,
            clone:Hsa11-digit02-11-14-R.
ACCESSION   AB231703
VERSION     AB231703.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 217)
  AUTHORS   Totoki,Y., Yada,T., Sakaki,Y. and Takeda,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Yasushi Totoki
            RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho, Tsurumi-ku,
            Yokohama, Kanagawa 230-0045, Japan
REFERENCE   2
  AUTHORS   Totoki,Y., Yada,T., Sakaki,Y. and Takeda,T.
  TITLE     Identification of novel human genes predicted by combining
            multiple gene-finders
  JOURNAL   Unpublished (2005)
COMMENT     This sequence is a novel human gene predicted by DIGIT 
            (Yada et al. Pac Symp Biocomput, 8;375-387. 2003), 
            an ab-initio gene-finder which finds genes by combining 
            gene predictions from multiple ab initio gene-finders 
            such as FGENESH, GENSCAN and HMMgene. 
            This sequence was verified by RT-PCR.
FEATURES             Location/Qualifiers
     source          1..217
                     /chromosome="11"
                     /clone="Hsa11-digit02-11-14-R"
                     /db_xref="H-InvDB:HIT000329943"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="similar to ref|XM_508541.1| PREDICTED: Pan
                     troglodytes similar to cell division cycle associated 5
                     (LOC451310), mRNA"
                     /organism="Homo sapiens"
     CDS             <1..>217
                     /codon_start=3
                     /product="hypothetical protein"
                     /protein_id="BAE46873.1"
                     /translation="QFLDQEDWGPQRTSKEIRQLQNDCMRLRESLNTTQVHNLALGEK
                     LQNLPTLLYKSLKEGAQAIQEEAQAIQ"
BASE COUNT           58 a           61 c           67 g           31 t
ORIGIN      
        1 accagttctt agatcaggag gactggggcc cccagcggac ctcaaaggag atcaggcagt
       61 tgcagaatga ctgcatgagg cttcgggagt cactgaacac cacccaagtg cacaacctgg
      121 ccctggggga gaagctgcag aacctgccca ccttattgta taagagcctg aaggagggag
      181 cccaggccat ccaggaggag gcccaggcca tccagga
//