LOCUS AB231703 217 bp mRNA linear HUM 20-OCT-2005 DEFINITION Homo sapiens mRNA for hypothetical protein, partial cds, clone:Hsa11-digit02-11-14-R. ACCESSION AB231703 VERSION AB231703.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 217) AUTHORS Totoki,Y., Yada,T., Sakaki,Y. and Takeda,T. TITLE Direct Submission JOURNAL Submitted (09-AUG-2005) to the DDBJ/EMBL/GenBank databases. Contact:Yasushi Totoki RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan REFERENCE 2 AUTHORS Totoki,Y., Yada,T., Sakaki,Y. and Takeda,T. TITLE Identification of novel human genes predicted by combining multiple gene-finders JOURNAL Unpublished (2005) COMMENT This sequence is a novel human gene predicted by DIGIT (Yada et al. Pac Symp Biocomput, 8;375-387. 2003), an ab-initio gene-finder which finds genes by combining gene predictions from multiple ab initio gene-finders such as FGENESH, GENSCAN and HMMgene. This sequence was verified by RT-PCR. FEATURES Location/Qualifiers source 1..217 /chromosome="11" /clone="Hsa11-digit02-11-14-R" /db_xref="H-InvDB:HIT000329943" /db_xref="taxon:9606" /mol_type="mRNA" /note="similar to ref|XM_508541.1| PREDICTED: Pan troglodytes similar to cell division cycle associated 5 (LOC451310), mRNA" /organism="Homo sapiens" CDS <1..>217 /codon_start=3 /product="hypothetical protein" /protein_id="BAE46873.1" /translation="QFLDQEDWGPQRTSKEIRQLQNDCMRLRESLNTTQVHNLALGEK LQNLPTLLYKSLKEGAQAIQEEAQAIQ" BASE COUNT 58 a 61 c 67 g 31 t ORIGIN 1 accagttctt agatcaggag gactggggcc cccagcggac ctcaaaggag atcaggcagt 61 tgcagaatga ctgcatgagg cttcgggagt cactgaacac cacccaagtg cacaacctgg 121 ccctggggga gaagctgcag aacctgccca ccttattgta taagagcctg aaggagggag 181 cccaggccat ccaggaggag gcccaggcca tccagga //