LOCUS AB212048 369 bp mRNA linear HUM 25-OCT-2005 DEFINITION Homo sapiens SDHC mRNA for succinate dehydrogenase complex, subunit C delta3+5 alternative splicing variant, complete cds. ACCESSION AB212048 VERSION AB212048.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 369) AUTHORS Hisatomi,H., Kitano,S., Kawano,K. and Hibi,N. TITLE Direct Submission JOURNAL Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases. Contact:Hisashi Hisatomi Analytical Center for Medical Science, SRL, Inc.; 153 Komiya-machi, Hachioji, Tokyo 191-0031, Japan REFERENCE 2 AUTHORS Hisatomi,H., Kitano,S., Kawano,K. and Hibi,N. TITLE Homo sapiens succinate dehydrogenase complex, subunit C mRNA, alternative splicing variant 4 JOURNAL Unpublished (2005) COMMENT FEATURES Location/Qualifiers source 1..369 /cell_line="A549" /chromosome="1" /db_xref="H-InvDB:HIT000329929" /db_xref="taxon:9606" /map="1q21" /mol_type="mRNA" /note="SDHC alternative splicing variant. The protein encoded by this gene is 53aa shorter than full-length isoform. This variant uses alternative splicing sites in it lacking 159nt (exons 3 and 5) in the coding region compared to the full-length isoform reported in Acc#NM_003001." /organism="Homo sapiens" CDS 19..369 /codon_start=1 /experiment="experimental evidence, no additional details recorded" /gene="SDHC" /product="succinate dehydrogenase complex, subunit C delta3+5 alternative splicing variant" /protein_id="BAE46980.1" /transl_table=1 /translation="MAALLLRHVGRHCLRAHFSPQLCIRNWSLPMAMSICHRGTGIAL SADVGPRKRPEDSPAIPVWSGCPGSYCVVLYGAGSHVKKGGSQHHLPTHYYIHPSFCL SFLSPAWEKFSLFV" BASE COUNT 73 a 98 c 87 g 111 t ORIGIN 1 tccagaccgg aacccaagat ggctgcgctg ttgctgagac acgttggtcg tcattgcctc 61 cgagcccact ttagccctca gctctgtatc agaaattggt ctcttcccat ggcgatgtcc 121 atctgccacc gtggcactgg tattgctttg agtgcagatg tgggacctag gaaaaggcct 181 gaagattccc cagctatacc agtctggagt ggttgtcctg gttcttactg tgttgtcctc 241 tatggggctg gcagccatgt gaagaaagga ggctcccagc atcatcttcc tacacattat 301 tacattcacc catctttctg tttgtcattc ttatctccag cctgggaaaa gttctcctta 361 tttgtttag //