LOCUS       AB212048                 369 bp    mRNA    linear   HUM 25-OCT-2005
DEFINITION  Homo sapiens SDHC mRNA for succinate dehydrogenase complex,
            subunit C delta3+5 alternative splicing variant, complete cds.
ACCESSION   AB212048
VERSION     AB212048.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 369)
  AUTHORS   Hisatomi,H., Kitano,S., Kawano,K. and Hibi,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Hisashi Hisatomi
            Analytical Center for Medical Science, SRL, Inc.; 153
            Komiya-machi, Hachioji, Tokyo 191-0031, Japan
REFERENCE   2
  AUTHORS   Hisatomi,H., Kitano,S., Kawano,K. and Hibi,N.
  TITLE     Homo sapiens succinate dehydrogenase complex, subunit C mRNA,
            alternative splicing variant 4
  JOURNAL   Unpublished (2005)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..369
                     /cell_line="A549"
                     /chromosome="1"
                     /db_xref="H-InvDB:HIT000329929"
                     /db_xref="taxon:9606"
                     /map="1q21"
                     /mol_type="mRNA"
                     /note="SDHC alternative splicing variant. The protein
                     encoded by this gene is 53aa shorter than full-length
                     isoform. This variant uses alternative splicing sites in
                     it lacking 159nt (exons 3 and 5) in the coding region
                     compared to the full-length isoform reported in
                     Acc#NM_003001."
                     /organism="Homo sapiens"
     CDS             19..369
                     /codon_start=1
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /gene="SDHC"
                     /product="succinate dehydrogenase complex, subunit C
                     delta3+5 alternative splicing variant"
                     /protein_id="BAE46980.1"
                     /transl_table=1
                     /translation="MAALLLRHVGRHCLRAHFSPQLCIRNWSLPMAMSICHRGTGIAL
                     SADVGPRKRPEDSPAIPVWSGCPGSYCVVLYGAGSHVKKGGSQHHLPTHYYIHPSFCL
                     SFLSPAWEKFSLFV"
BASE COUNT           73 a           98 c           87 g          111 t
ORIGIN      
        1 tccagaccgg aacccaagat ggctgcgctg ttgctgagac acgttggtcg tcattgcctc
       61 cgagcccact ttagccctca gctctgtatc agaaattggt ctcttcccat ggcgatgtcc
      121 atctgccacc gtggcactgg tattgctttg agtgcagatg tgggacctag gaaaaggcct
      181 gaagattccc cagctatacc agtctggagt ggttgtcctg gttcttactg tgttgtcctc
      241 tatggggctg gcagccatgt gaagaaagga ggctcccagc atcatcttcc tacacattat
      301 tacattcacc catctttctg tttgtcattc ttatctccag cctgggaaaa gttctcctta
      361 tttgtttag
//