LOCUS AB211234 460 bp mRNA linear HUM 25-OCT-2005 DEFINITION Homo sapiens SDHC mRNA for succinate dehydrogenase complex, subunit C delta3 alternative splicing variant, complete cds. ACCESSION AB211234 VERSION AB211234.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 460) AUTHORS Hisatomi,H., Kitano,S., Kawano,K. and Hibi,N. TITLE Direct Submission JOURNAL Submitted (14-APR-2005) to the DDBJ/EMBL/GenBank databases. Contact:Hisashi Hisatomi SRL,Inc., Analytical Center for Medical Science; 153 Komiya-machi, Hachioji, Tokyo 191-0031, Japan REFERENCE 2 AUTHORS Hiatomi,H., Kitano,S., Kawano,K. and Hibi,N. TITLE Homo sapiens succinate dehydrogenase complex, subunit C mRNA, alternative splicing variant 2 JOURNAL Unpublished (2005) COMMENT FEATURES Location/Qualifiers source 1..460 /cell_line="A549" /chromosome="1" /db_xref="H-InvDB:HIT000329926" /db_xref="taxon:9606" /map="1q21" /mol_type="mRNA" /note="SDHC alternative splicing variant. The protein encoded by this gene is 34aa shorter than full-length isoform. This variant uses alternative splice site resulting in it lacking 102nt (exon3) in the coding region compared to the full-length isoform reported in Acc#NM_003001." /organism="Homo sapiens" CDS 25..432 /codon_start=1 /experiment="experimental evidence, no additional details recorded" /gene="SDHC" /product="succinate dehydrogenase complex, subunit C delta3 alternative splicing variant" /protein_id="BAE46978.1" /transl_table=1 /translation="MAALLLRHVGRHCLRAHFSPQLCIRNWSLPMAMSICHRGTGIAL SAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLM WDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM" BASE COUNT 84 a 125 c 118 g 133 t ORIGIN 1 cttccgtcca gaccggaacc caagatggct gcgctgttgc tgagacacgt tggtcgtcat 61 tgcctccgag cccactttag ccctcagctc tgtatcagaa attggtctct tcccatggcg 121 atgtccatct gccaccgtgg cactggtatt gctttgagtg caggggtctc tctttttggc 181 atgtcggccc tgttactccc tgggaacttt gagtcttatt tggaacttgt gaagtccctg 241 tgtctggggc cagcactgat ccacacagct aagtttgcac ttgtcttccc tctcatgtat 301 catacctgga atgggatccg acacttgatg tgggacctag gaaaaggcct gaagattccc 361 cagctatacc agtctggagt ggttgtcctg gttcttactg tgttgtcctc tatggggctg 421 gcagccatgt gaagaaagga ggctcccagc atcatcttcc //