LOCUS       AB211234                 460 bp    mRNA    linear   HUM 25-OCT-2005
DEFINITION  Homo sapiens SDHC mRNA for succinate dehydrogenase complex,
            subunit C delta3 alternative splicing variant, complete cds.
ACCESSION   AB211234
VERSION     AB211234.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 460)
  AUTHORS   Hisatomi,H., Kitano,S., Kawano,K. and Hibi,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-APR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Hisashi Hisatomi
            SRL,Inc., Analytical Center for Medical Science; 153 Komiya-machi,
            Hachioji, Tokyo 191-0031, Japan
REFERENCE   2
  AUTHORS   Hiatomi,H., Kitano,S., Kawano,K. and Hibi,N.
  TITLE     Homo sapiens succinate dehydrogenase complex, subunit C mRNA,
            alternative splicing variant 2
  JOURNAL   Unpublished (2005)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..460
                     /cell_line="A549"
                     /chromosome="1"
                     /db_xref="H-InvDB:HIT000329926"
                     /db_xref="taxon:9606"
                     /map="1q21"
                     /mol_type="mRNA"
                     /note="SDHC alternative splicing variant. The protein
                     encoded by this gene is 34aa shorter than full-length
                     isoform. This variant uses alternative splice site
                     resulting in it lacking 102nt (exon3) in the coding
                     region compared to the full-length isoform reported in
                     Acc#NM_003001."
                     /organism="Homo sapiens"
     CDS             25..432
                     /codon_start=1
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /gene="SDHC"
                     /product="succinate dehydrogenase complex, subunit C
                     delta3 alternative splicing variant"
                     /protein_id="BAE46978.1"
                     /transl_table=1
                     /translation="MAALLLRHVGRHCLRAHFSPQLCIRNWSLPMAMSICHRGTGIAL
                     SAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLM
                     WDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM"
BASE COUNT           84 a          125 c          118 g          133 t
ORIGIN      
        1 cttccgtcca gaccggaacc caagatggct gcgctgttgc tgagacacgt tggtcgtcat
       61 tgcctccgag cccactttag ccctcagctc tgtatcagaa attggtctct tcccatggcg
      121 atgtccatct gccaccgtgg cactggtatt gctttgagtg caggggtctc tctttttggc
      181 atgtcggccc tgttactccc tgggaacttt gagtcttatt tggaacttgt gaagtccctg
      241 tgtctggggc cagcactgat ccacacagct aagtttgcac ttgtcttccc tctcatgtat
      301 catacctgga atgggatccg acacttgatg tgggacctag gaaaaggcct gaagattccc
      361 cagctatacc agtctggagt ggttgtcctg gttcttactg tgttgtcctc tatggggctg
      421 gcagccatgt gaagaaagga ggctcccagc atcatcttcc
//