LOCUS AB174649 1692 bp mRNA linear PRI 06-MAR-2007
DEFINITION Macaca fascicularis brain cDNA clone: QtrA-18438, similar to human
protocadherin gamma subfamily C, 3 (PCDHGC3), transcriptvariant 1,
mRNA, RefSeq: NM_002588.2.
ACCESSION AB174649
VERSION AB174649.1
KEYWORDS oligo capping; fis (full insert sequence).
SOURCE Macaca fascicularis (crab-eating macaque)
ORGANISM Macaca fascicularis
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
REFERENCE 1 (bases 1 to 1692)
AUTHORS Chien,H.-C., Wang,H.-Y., Liu,Y.-L., Wu,K.-M., Ho,T.-C., Tsai,S.-F.
and Shen,C.-K.J.
TITLE Direct Submission
JOURNAL Submitted (19-MAR-2004) to the DDBJ/EMBL/GenBank databases.
Contact:Che-Kun James Shen
Institute of Molecular Biology, Academia Sinica (IMB, AC); 128,
Section 2, Academy Road, Taipei 115, Taiwan
URL :http://www.imb.sinica.edu.tw
REFERENCE 2
AUTHORS Wang,H.-Y., Chien,H.-C., Osada,N., Hashimoto,K., Sugano,S.,
Gojobori,T., Chou,C.-K., Tsai,S.-F., Wu,C.-I. and Shen,C.-K.J.
TITLE Rate of Evolution in Brain-Expressed Genes in Humans and Other
Primates
JOURNAL PLoS Biol. 5, e13 (2007)
COMMENT The International consortium for macaque cDNA sequencing
and analysis consists of: Department of Virology and Human
Genome Center, Institute of Medical Science, The University of
Tokyo, Tokyo, Japan; Division of Genetic Resources, National
Institute of Infectious Diseases of Japan, Tokyo, Japan; National
Health Research Institute, Taipei, Taiwan; Institute of Molecular
Biology, Academia Sinica, Taipei, Taiwan; Department of Ecology &
Evolution, University of Chicago, Chicago, IL, USA; Center for
Information Biology, National Institute of Genetics of Japan,
Mishima, Japan.
Clone distribution: clone distribution information can be
found at: http://www.nih.go.jp/yoken/genebank/
Lab host: TOP10
Vector: pME18S-FL3 (Acc.No. AB009864)
R. Site1: DraIII (CACTGTGTG)
R. Site2: DraIII (CACCATGTG)
Description: 1st strand cDNA was primed with an oligo(dT) primer
[ATGTGGCCTTTTTTTTTTTTTTTTT]; double-stranded cDNA was
synthesized using specific 5' and 3' primers and amplified
by PCR. The PCR product was digested with SfiI and size selection
was performed to exclude fragments <1.5kb.The SfiI-digested
PCR product was cloned into distinct DraIII sites of pME18S-FL3.
XhoI sites just outside the DraIII sites can be used to
isolate the cDNA insert. Libraries were constructed by
oligo-capping method. Libraries were made from:
QccE: cerebellum cortex
QnpA: parietal lobe
QtrA: temporal lobe right
QflA: frontal lobe left
QmoA: medulla oblongata
QbsA: brain stem
QorA: occipital lobe right
QtsA: testis
Custom primers were used for 5' and 3'-end sequencing. The
full-insert sequencing was done by primer-walking method using ABI
DNA sequencer.
FEATURES Location/Qualifiers
source 1..1692
/clone="QtrA-18438"
/clone_lib="macaque cDNA library QtrA"
/db_xref="taxon:9541"
/dev_stage="adult"
/mol_type="mRNA"
/organism="Macaca fascicularis"
/sex="male"
CDS 116..667
/note="Homo sapiens protocadherin gamma subfamily C, 3
(PCDHGC3), transcriptvariant 1, mRNA, RefSeq: NM_002588.2"
/protein_id="BAE91711.1"
/translation="MSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPV
FYRQVLGAESAPPGQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTEMLQVM
ILASASEAADGSSILGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGTNATLTNAAG
KRDGKAPAGGNGNKKKSGKKEKK"
BASE COUNT 380 a 528 c 420 g 364 t
ORIGIN
1 aatattcaaa gtttacaagt ggaagcagtc tagagaccta taccgagccc cagtgagctc
61 actgtaccga acaccagggc cctccttgca cgcagacgcc gtgcggggag gcctgatgtc
121 gccgcacctt taccatcagg tgtatctcac cacggactcc cgccgcagcg acccgctgct
181 gaagaaacct ggtgcagcca gcccactggc cagccgccag aacacgctgc ggagctgcga
241 tccggtgttc tataggcagg tgttgggcgc agagagcgcc cctcccggac agcaagcccc
301 gcccaacacg gactggcgtt tctctcaggc ccagagaccc ggcaccagcg gctcccaaaa
361 tggcgatgac accggcacct ggcccaacaa ccagtttgac acagagatgc tgcaagtcat
421 gatcttggcc tccgccagtg aagccgctga tgggagctcc atcctgggag gcggtgccgg
481 caccatgggc ttgagcgccc gctacggacc ccagttcacc ctgcagcatg tgcccgacta
541 ccgccagaac gtctacatcc caggcaccaa tgccacgctg accaatgcag ctggcaagcg
601 ggatggcaag gccccagcag gtggcaatgg caacaagaag aagtcgggca agaaggagaa
661 gaagtaacat ggaggccagg ccaagagcca cagggcagcc tccccccaac cagcccagct
721 tctccttacc tgtacccagg cctcagagtt tcagggctca cccccagaat actggtaggg
781 gccaaggcca tgctcccctt gggaaacaga aacaagtgcc cagtcaacac ccatcccctt
841 accccccggg ggttgaatat gcaaagggag ttctgctggg aacccccatc caatcaattg
901 ctgtacccat gggggtagtg gggttagtgt agacaccaag aaccatttgc cacacccatt
961 tagttatagc tgaactcctc catcttccaa atcaatcagg cccatccatc ccatgcctcc
1021 ctcctcccca cccaactcca acagttcctc tctcctgagt aagttggttg gggtgttgaa
1081 gtaccaggta acctacaaga ctcctagttc tgaagagctg gaagggtatc atgacctctt
1141 ggcctctcct ttgattctca atcttccccc aaagcatggt ttggtgccag ccccttcacc
1201 tccttccaga gcctgagatc aatgctcaag ttttggagga catggtcacc atccccatgg
1261 tactgatgct cgctggattt agggagggca ttttgctacc aaggctcttc ccaacgccct
1321 ggggaccagt cttctgtttt gtttttcatt gttcgacgtt ccctctttcg gctggtgtag
1381 aatagccagt agtgtagtac ggtgtgcttt tacgtgatgg cgggtgggca gcgggcggcg
1441 ggctccgcgc agccgtctgt ccttgatctg cccgcggcgg cccgtgttgt gttttgtgct
1501 gtgtccacgc gctaaggcga ccccctcccc catactgact ccttctataa gcgcttctct
1561 tcgcatagtc acgtagctcc taccccaccg tcttcctgtg tctcacgcaa gttttatact
1621 ctaatattta tatggctttt tttcttcgac aaaaaaataa taaaaaggtt tcttctgaaa
1681 aaaaaaaaaa aa
//