LOCUS AB171003 1770 bp mRNA linear PRI 06-MAR-2007
DEFINITION Macaca fascicularis brain cDNA clone: QorA-11745, similar to human
prosaposin (variant Gaucher disease and variantmetachromatic
leukodystrophy) (PSAP), mRNA, RefSeq: NM_002778.1.
ACCESSION AB171003
VERSION AB171003.1
KEYWORDS oligo capping; fis (full insert sequence).
SOURCE Macaca fascicularis (crab-eating macaque)
ORGANISM Macaca fascicularis
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
REFERENCE 1 (bases 1 to 1770)
AUTHORS Chien,H.-C., Wang,H.-Y., Liu,Y.-L., Wu,K.-M., Ho,T.-C., Tsai,S.-F.
and Shen,C.-K.J.
TITLE Direct Submission
JOURNAL Submitted (19-MAR-2004) to the DDBJ/EMBL/GenBank databases.
Contact:Che-Kun James Shen
Institute of Molecular Biology, Academia Sinica (IMB, AC); 128,
Section 2, Academy Road, Taipei 115, Taiwan
URL :http://www.imb.sinica.edu.tw
REFERENCE 2
AUTHORS Wang,H.-Y., Chien,H.-C., Osada,N., Hashimoto,K., Sugano,S.,
Gojobori,T., Chou,C.-K., Tsai,S.-F., Wu,C.-I. and Shen,C.-K.J.
TITLE Rate of Evolution in Brain-Expressed Genes in Humans and Other
Primates
JOURNAL PLoS Biol. 5, e13 (2007)
COMMENT The International consortium for macaque cDNA sequencing
and analysis consists of: Department of Virology and Human
Genome Center, Institute of Medical Science, The University of
Tokyo, Tokyo, Japan; Division of Genetic Resources, National
Institute of Infectious Diseases of Japan, Tokyo, Japan; National
Health Research Institute, Taipei, Taiwan; Institute of Molecular
Biology, Academia Sinica, Taipei, Taiwan; Department of Ecology &
Evolution, University of Chicago, Chicago, IL, USA; Center for
Information Biology, National Institute of Genetics of Japan,
Mishima, Japan.
Clone distribution: clone distribution information can be
found at: http://www.nih.go.jp/yoken/genebank/
Lab host: TOP10
Vector: pME18S-FL3 (Acc.No. AB009864)
R. Site1: DraIII (CACTGTGTG)
R. Site2: DraIII (CACCATGTG)
Description: 1st strand cDNA was primed with an oligo(dT) primer
[ATGTGGCCTTTTTTTTTTTTTTTTT]; double-stranded cDNA was
synthesized using specific 5' and 3' primers and amplified
by PCR. The PCR product was digested with SfiI and size selection
was performed to exclude fragments <1.5kb.The SfiI-digested
PCR product was cloned into distinct DraIII sites of pME18S-FL3.
XhoI sites just outside the DraIII sites can be used to
isolate the cDNA insert. Libraries were constructed by
oligo-capping method. Libraries were made from:
QccE: cerebellum cortex
QnpA: parietal lobe
QtrA: temporal lobe right
QflA: frontal lobe left
QmoA: medulla oblongata
QbsA: brain stem
QorA: occipital lobe right
QtsA: testis
Custom primers were used for 5' and 3'-end sequencing. The
full-insert sequencing was done by primer-walking method using ABI
DNA sequencer.
FEATURES Location/Qualifiers
source 1..1770
/clone="QorA-11745"
/clone_lib="macaque cDNA library QorA"
/db_xref="taxon:9541"
/dev_stage="adult"
/mol_type="mRNA"
/organism="Macaca fascicularis"
/sex="male"
CDS 795..1361
/note="Homo sapiens prosaposin (variant Gaucher disease
and variantmetachromatic leukodystrophy) (PSAP), mRNA,
RefSeq: NM_002778.1"
/protein_id="BAE88066.1"
/translation="MADMCKNYISQYSEIAIQMMMHMQDQQPKEICALVGFCDEVKEM
PMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTE
KEILDTFDKMCSKLPKSLSEECQEVVDTYGSSILSILLQEVSPELVCSMLRLCSGTRL
PALTVHMTQPKDGGFCEVCKKLVGYLDQ"
BASE COUNT 446 a 444 c 503 g 377 t
ORIGIN
1 actggacggc ttcggggcag ggcagattta tatctgcggg gatcagctga cgcgccgcat
61 tgcagactgc ggagtcaggc ggcgctatgt acgctctctt cctcctggcc agcctcctgg
121 gcgcggctct agccagccca gtcctcggaa tgaaagaatg caccagaggc tcggcagtgt
181 ggtgccagaa tgtgaagacg gcatccgact gcggggcagt gaagcactgc ctgcagaccg
241 tttggaacaa gccgacagtg aaatcccttc cttgtgacat atgcaaagat gttgtcaccg
301 cagctggtga tatgctgaag gacaatgcca ccgaggagga gatccttgtt tacttggaga
361 agacctgtga ctggcttccg aaaccgaaca tgtctgcttc gtgcaaggag atagtggact
421 cctacctccc tgtcatcctg gacatcatta aaggagaaat gagccgtcct gggggaggtg
481 tgctctgctc tcaacctctg cgagtctctc cagaagcacc tggcagagct gaatcaccag
541 aaacagctgg agtccaataa gatcccagag ctggacatga ctgaggtggt ggcccccttc
601 atggccaaca tccctctcct cctctaccct caggacagcc cccgcagcaa gccccagcca
661 aaggataatg gggacgtttg ccaggactgc attcagatgg tgaccgacat ccagactgct
721 gtacggacaa ctccaccttt gtccaggcct tggtggaaca tgtcaaggag gagtgtgacc
781 gcctgggccc tggcatggcc gacatgtgca agaactatat cagccagtat tctgaaattg
841 ctatccagat gatgatgcac atgcaggatc agcaacccaa ggagatctgt gcgctggttg
901 ggttctgtga tgaggtgaaa gagatgccca tgcagactct ggtccccgcc aaagtggcct
961 ccaagaatgt catccctgcc ctggaactgg tggagcccat taagaagcac gaggtcccag
1021 caaagtctga tgtttactgt gaggtgtgtg aattcctggt gaaggaggtg accaagctga
1081 ttgacaacaa caagactgag aaagaaatac tcgacacttt tgacaaaatg tgctcgaagc
1141 tgccgaagtc cctgtcggaa gagtgccagg aggtggtgga cacgtacggc agctcaatcc
1201 tgtccatcct gctgcaggag gtcagccctg agctggtgtg cagcatgctg cgcctctgct
1261 ctggcacgcg gctgcctgcg ctgaccgttc atatgactca gccgaaggac ggtggcttct
1321 gcgaagtgtg caagaagctg gtgggttatt tggatcagta acctggagaa aaacagcacc
1381 aagcaggaga tcctggctgc tcttgagaaa ggctgcagct tcctgcccga cccttaccag
1441 aagcagtgtg atcagtttgt ggcagagtac gagcccgtgc tgatcgagat cctggtggag
1501 gtgatggatc cttcgttcgt gtgtatgggg cccaagctac tggtgccaga acacagagac
1561 ggcagcccag tgcaatgctg tcgagcattg caaacgccac gtgtggaact aggaggagga
1621 atattccagc ttggagaaac tgcagcaagc aaagccagca ggatacgcag ttgttattaa
1681 atggactttg tgagttttgt tttgcactaa agtttctgtg atttaacaat aaaattctgt
1741 tagccaaaaa aaaaaaaaaa aaaaaaaaaa
//