LOCUS AB121028 950 bp mRNA linear HUM 11-JAN-2007 DEFINITION Homo sapiens HANP1 mRNA for haploid germ cell-specific nuclear protein 1, complete cds. ACCESSION AB121028 VERSION AB121028.2 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 950) AUTHORS Onishi,M., Tanaka,H., Nozaki,M. and Nishimune,Y. TITLE Direct Submission JOURNAL Submitted (25-SEP-2003) to the DDBJ/EMBL/GenBank databases. Contact:Masayoshi Onishi Research Institute for Microbial Diseases, Osaka Univ., Department of Science for Laboratory Animal Experimentation; 3-1, Yamadaoka, Suita, Osaka 565-0871, Japan URL :http://www.biken.osaka-u.ac.jp/biken/animal/english/index- e.html REFERENCE 2 AUTHORS Tanaka,H., Matsuoka,Y., Onishi,M., Kitamura,K., Miyagawa,Y., Nishimura,H., Tsujimura,A., Okuyama,A. and Nishimune,Y. TITLE Expression profiles and single-nucleotide polymorphism analysis of human HANP1/H1T2 encoding a histone H1-like protein JOURNAL Int. J. Androl. 29, 353-359 (2006) COMMENT FEATURES Location/Qualifiers source 1..950 /db_xref="H-InvDB:HIT000242408" /db_xref="taxon:9606" /mol_type="mRNA" /organism="Homo sapiens" /tissue_type="testis" CDS 16..720 /codon_start=1 /gene="HANP1" /note="SNP information was identified using a genomic DNA of a blood" /product="haploid germ cell-specific nuclear protein 1" /protein_id="BAD13382.2" /transl_table=1 /translation="MAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVL QAISTHKGLTLAALKKELRNAGYEVRRKSGRHEAPRGQAKATLLRVSGSDAAGYFRVW KVPKPRRKPGRARQEEGTRAPWRTPAAPRSSRRRRQPLRKAARKAREVWRRNARAKAK ANARARRTRRARPRAKEPPCARAKEEAGATAADEGRGQAVKEDTTPRSGKDKRRSSKP REEKQEPKKPAQRTIQ" variation 202 /note="SNP information" /note="This substitution causes an amino acid substitution from Arg to Gly" /replace="g" variation 275 /note="SNP information" /note="This substitution causes an amino acid substitution from Lue to Pro" /replace="c" variation 360 /note="SNP information" /note="This substitution causes an amino acid substitution from Arg to Ser" /replace="t" variation 473 /note="SNP information" /note="This substitution causes an amino acid substitution from Arg to Gln" /replace="a" variation 662 /note="SNP information" /note="This substitution causes an amino acid substitution from Ser to Phe" /replace="t" BASE COUNT 246 a 287 c 318 g 99 t ORIGIN 1 ggcgggagtg gggccatggc tgaggcgcct gggcccagtg gcgaatcccg aggacactca 61 gccactcagc tgccagcgga aaaaactgtc gggggaccat cgaggggctg ctcaagctcc 121 gtgctcagag tgtcccagtt ggtgctccag gccatctcca ctcacaaagg gctgactctg 181 gcagctctca agaaggagct ccgaaacgcc ggctacgaag tgcgcaggaa gagcggccgc 241 cacgaagcgc ccagggggca ggccaaggcc acgctcctcc gggtcagcgg cagcgacgcc 301 gccggctact tcagggtctg gaaggttccc aagcccagga gaaagccggg acgcgcgagg 361 caagaggagg gcacgcgcgc tccctggagg accccagccg cgccccggag ctcccggagg 421 cgccgccagc cccttcgcaa ggcggccagg aaggccagag aagtgtggag acggaacgcg 481 agggcgaaag ccaaggccaa tgccagggcg aggaggacca ggagggcaag gccgagagcc 541 aaggagccgc cgtgtgccag agccaaggag gaagcgggag cgacagcggc agacgagggg 601 cgaggacagg ccgtgaagga agacaccacg ccgaggtcag ggaaggacaa gaggcgaagc 661 tccaagccca gggaagagaa gcaggagccc aagaagcccg cacagcggac catccagtag 721 ccaacgcggg ctaaaaccga ccggacatct agcgggcagg ggaagactcc actaaagact 781 tccacaaaga cctcccctaa atctgaaggt cttcctgatc cagttgggaa tgcatcttgt 841 gggagcagct tcactcccac cacggaccaa tgcctttccc acataggccc caagaagagc 901 ggctgtcaca ctcattgaaa tgaaatggac ctctagacca aaaaaaaaaa //