LOCUS       AB121028                 950 bp    mRNA    linear   HUM 11-JAN-2007
DEFINITION  Homo sapiens HANP1 mRNA for haploid germ cell-specific nuclear
            protein 1, complete cds.
ACCESSION   AB121028
VERSION     AB121028.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 950)
  AUTHORS   Onishi,M., Tanaka,H., Nozaki,M. and Nishimune,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2003) to the DDBJ/EMBL/GenBank databases.
            Contact:Masayoshi Onishi
            Research Institute for Microbial Diseases, Osaka Univ., Department
            of Science for Laboratory Animal Experimentation; 3-1, Yamadaoka,
            Suita, Osaka 565-0871, Japan
            URL    :http://www.biken.osaka-u.ac.jp/biken/animal/english/index-
            e.html
REFERENCE   2
  AUTHORS   Tanaka,H., Matsuoka,Y., Onishi,M., Kitamura,K., Miyagawa,Y.,
            Nishimura,H., Tsujimura,A., Okuyama,A. and Nishimune,Y.
  TITLE     Expression profiles and single-nucleotide polymorphism analysis of
            human HANP1/H1T2 encoding a histone H1-like protein
  JOURNAL   Int. J. Androl. 29, 353-359 (2006)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..950
                     /db_xref="H-InvDB:HIT000242408"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /tissue_type="testis"
     CDS             16..720
                     /codon_start=1
                     /gene="HANP1"
                     /note="SNP information was identified using a genomic DNA
                     of a blood"
                     /product="haploid germ cell-specific nuclear protein 1"
                     /protein_id="BAD13382.2"
                     /transl_table=1
                     /translation="MAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVL
                     QAISTHKGLTLAALKKELRNAGYEVRRKSGRHEAPRGQAKATLLRVSGSDAAGYFRVW
                     KVPKPRRKPGRARQEEGTRAPWRTPAAPRSSRRRRQPLRKAARKAREVWRRNARAKAK
                     ANARARRTRRARPRAKEPPCARAKEEAGATAADEGRGQAVKEDTTPRSGKDKRRSSKP
                     REEKQEPKKPAQRTIQ"
     variation       202
                     /note="SNP information"
                     /note="This substitution causes an amino acid
                     substitution from Arg to Gly"
                     /replace="g"
     variation       275
                     /note="SNP information"
                     /note="This substitution causes an amino acid
                     substitution from Lue to Pro"
                     /replace="c"
     variation       360
                     /note="SNP information"
                     /note="This substitution causes an amino acid
                     substitution from Arg to Ser"
                     /replace="t"
     variation       473
                     /note="SNP information"
                     /note="This substitution causes an amino acid
                     substitution from Arg to Gln"
                     /replace="a"
     variation       662
                     /note="SNP information"
                     /note="This substitution causes an amino acid
                     substitution from Ser to Phe"
                     /replace="t"
BASE COUNT          246 a          287 c          318 g           99 t
ORIGIN      
        1 ggcgggagtg gggccatggc tgaggcgcct gggcccagtg gcgaatcccg aggacactca
       61 gccactcagc tgccagcgga aaaaactgtc gggggaccat cgaggggctg ctcaagctcc
      121 gtgctcagag tgtcccagtt ggtgctccag gccatctcca ctcacaaagg gctgactctg
      181 gcagctctca agaaggagct ccgaaacgcc ggctacgaag tgcgcaggaa gagcggccgc
      241 cacgaagcgc ccagggggca ggccaaggcc acgctcctcc gggtcagcgg cagcgacgcc
      301 gccggctact tcagggtctg gaaggttccc aagcccagga gaaagccggg acgcgcgagg
      361 caagaggagg gcacgcgcgc tccctggagg accccagccg cgccccggag ctcccggagg
      421 cgccgccagc cccttcgcaa ggcggccagg aaggccagag aagtgtggag acggaacgcg
      481 agggcgaaag ccaaggccaa tgccagggcg aggaggacca ggagggcaag gccgagagcc
      541 aaggagccgc cgtgtgccag agccaaggag gaagcgggag cgacagcggc agacgagggg
      601 cgaggacagg ccgtgaagga agacaccacg ccgaggtcag ggaaggacaa gaggcgaagc
      661 tccaagccca gggaagagaa gcaggagccc aagaagcccg cacagcggac catccagtag
      721 ccaacgcggg ctaaaaccga ccggacatct agcgggcagg ggaagactcc actaaagact
      781 tccacaaaga cctcccctaa atctgaaggt cttcctgatc cagttgggaa tgcatcttgt
      841 gggagcagct tcactcccac cacggaccaa tgcctttccc acataggccc caagaagagc
      901 ggctgtcaca ctcattgaaa tgaaatggac ctctagacca aaaaaaaaaa
//