LOCUS AB115416 113 bp mRNA linear HUM 01-OCT-2004 DEFINITION Homo sapiens GluR4c mRNA for alternative splicing isoform of ionotrophic glutamate receptor subunit, partial cds. ACCESSION AB115416 VERSION AB115416.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 113) AUTHORS Kawahara,Y., Ito,K., Sun,H., Kanazawa,I. and Kwak,S. TITLE Direct Submission JOURNAL Submitted (22-JUL-2003) to the DDBJ/EMBL/GenBank databases. Contact:Yukio Kawahara University of Tokyo, Graduate School of Medicine, Department of Neurology; 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8655, Japan REFERENCE 2 AUTHORS Kawahara,Y., Ito,K., Sun,H., Ito,M., Kanazawa,I. and Kwak,S. TITLE GluR4c, an alternative splicing isoform of GluR4, is abundantly expressed in the adult human brain JOURNAL Brain Res. Mol. Brain Res. 127, 150-155 (2004) COMMENT FEATURES Location/Qualifiers source 1..113 /db_xref="H-InvDB:HIT000242382" /db_xref="taxon:9606" /mol_type="mRNA" /organism="Homo sapiens" CDS <1..111 /codon_start=1 /gene="GluR4c" /product="alternative splicing isoform of ionotrophic glutamate receptor subunit" /protein_id="BAD23796.1" /transl_table=1 /translation="VAKSAQTFNPTSSQNTQNLATYREGYNVYGTESIKI" BASE COUNT 42 a 22 c 23 g 26 t ORIGIN 1 gtggcaaaga gtgcacagac ttttaaccca acttcctcgc agaataccca gaatttagca 61 acctatagag aaggttacaa cgtatatgga accgaaagta ttaaaattta ggg //