LOCUS       AB115416                 113 bp    mRNA    linear   HUM 01-OCT-2004
DEFINITION  Homo sapiens GluR4c mRNA for alternative splicing isoform of
            ionotrophic glutamate receptor subunit, partial cds.
ACCESSION   AB115416
VERSION     AB115416.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 113)
  AUTHORS   Kawahara,Y., Ito,K., Sun,H., Kanazawa,I. and Kwak,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUL-2003) to the DDBJ/EMBL/GenBank databases.
            Contact:Yukio Kawahara
            University of Tokyo, Graduate School of Medicine, Department of
            Neurology; 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8655, Japan
REFERENCE   2
  AUTHORS   Kawahara,Y., Ito,K., Sun,H., Ito,M., Kanazawa,I. and Kwak,S.
  TITLE     GluR4c, an alternative splicing isoform of GluR4, is abundantly
            expressed in the adult human brain
  JOURNAL   Brain Res. Mol. Brain Res. 127, 150-155 (2004)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..113
                     /db_xref="H-InvDB:HIT000242382"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
     CDS             <1..111
                     /codon_start=1
                     /gene="GluR4c"
                     /product="alternative splicing isoform of ionotrophic
                     glutamate receptor subunit"
                     /protein_id="BAD23796.1"
                     /transl_table=1
                     /translation="VAKSAQTFNPTSSQNTQNLATYREGYNVYGTESIKI"
BASE COUNT           42 a           22 c           23 g           26 t
ORIGIN      
        1 gtggcaaaga gtgcacagac ttttaaccca acttcctcgc agaataccca gaatttagca
       61 acctatagag aaggttacaa cgtatatgga accgaaagta ttaaaattta ggg
//