LOCUS AB065915 1294 bp DNA linear HUM 23-JUL-2002 DEFINITION Homo sapiens gene for seven transmembrane helix receptor, complete cds, isolate:CBRC7TM_478. ACCESSION AB065915 VERSION AB065915.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1294) AUTHORS Suwa,M. TITLE Direct Submission JOURNAL Submitted (11-JUL-2001) to the DDBJ/EMBL/GenBank databases. Contact:Makiko Suwa Computational Biology Research Center (CBRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi Koto-ku, Tokyo 135-0064, Japan URL :http://www.cbrc.jp/ REFERENCE 2 AUTHORS Suwa,M., Sato,T., Okouchi,I., Arita,M., Futami,K., Matsumoto,S., Tsutsumi,S., Aburatani,H., Asai,K. and Akiyama,Y. TITLE Genome-wide discovery and analysis of human seven transmembrane helix receptor genes. JOURNAL Unpublished (2001) COMMENT This sequence is a seven transmembrane helix receptor candidate predicted from the whole human genome sequences using our automated system that contains programs of gene finding(GeneDecoder), sequence search, motif-domain assignment and transmembrane helix prediction. And the sequence is submitted by the collaborative project between [Computational Biology Research Center (CBRC), National Institute of Advanced Industrial Science and Technology (AIST)] and [Genome Science Division, Research Center for Advanced Science and Technology (RCAST), University of Tokyo]. FEATURES Location/Qualifiers source 1..1294 /chromosome="18" /db_xref="H-InvDB:HIT000383511" /db_xref="taxon:9606" /isolate="CBRC7TM_478" /mol_type="genomic DNA" /organism="Homo sapiens" CDS 201..1094 /codon_start=1 /inference="non-experimental evidence, no additional details recorded" /product="seven transmembrane helix receptor" /protein_id="BAC06130.1" /translation="MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLI VLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTA DDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTG TGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGA ITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIY AFRSPELRDAFKKMIFCSRYW" BASE COUNT 306 a 342 c 277 g 369 t ORIGIN 1 tttaagcgag tgtggctggt ttttattttc tagtgtactt tgcaactaat atttctgtat 61 actccctttt aggtgattgg gagattttaa cttagatctc cagcaagtgc tacaaggaag 121 aaaagatcct gaagaatcaa tcaagttttc cgtgaagtca agtccaagta acatccccgc 181 cttaaccaca agcaggagaa atgaagcaca ttatcaactc gtatgaaaac atcaacaaca 241 cagcaagaaa taattccgac tgtcctcgtg tggttttgcc ggaggagata tttttcacaa 301 tttccattgt tggagttttg gagaatctga tcgtcctgct ggctgtgttc aagaataaga 361 atctccaggc acccatgtac tttttcatct gtagcttggc catatctgat atgctgggca 421 gcctatataa gatcttggaa aatatcctga tcatattgag aaacatgggc tatctcaagc 481 cacgtggcag ttttgaaacc acagccgatg acatcatcga ctccctgttt gtcctctccc 541 tgcttggctc catcttcagc ctgtctgtga ttgctgcgga ccgctacatc accatcttcc 601 acgcactgcg gtaccacagc atcgtgacca tgcgccgcac tgtggtggtg cttacggtca 661 tctggacgtt ctgcacgggg actggcatca ccatggtgat cttctcccat catgtgccca 721 cagtgatcac cttcacgtcg ctgttcccgc tgatgctggt cttcatcctg tgcctctatg 781 tgcacatgtt cctgctggct cgatcccaca ccaggaagat ctccaccctc cccagagcca 841 acatgaaagg ggccatcaca ctgaccatcc tgctcggggt cttcatcttc tgctgggccc 901 cctttgtgct tcatgtcctc ttgatgacat tctgcccaag taacccctac tgcgcctgct 961 acatgtctct cttccaggtg aacggcatgt tgatcatgtg caatgccgtc attgacccct 1021 tcatatatgc cttccggagc ccagagctca gggacgcatt caaaaagatg atcttctgca 1081 gcaggtactg gtagaatggc tgatccctgg ttttagaatc catgggaata acgttgccaa 1141 gtgccagaat agtgtaacat tccaacaaat gccagtgctc ctcactggcc ttccttccct 1201 aatggatgca aggatgatcc caccagctag tgtttctaat agctaggttc tatgtgaaca 1261 gtcttattgt aggggcaacc tcttaacttt gtga //