LOCUS       AB065915                1294 bp    DNA     linear   HUM 23-JUL-2002
DEFINITION  Homo sapiens gene for seven transmembrane helix receptor, complete
            cds, isolate:CBRC7TM_478.
ACCESSION   AB065915
VERSION     AB065915.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1294)
  AUTHORS   Suwa,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2001) to the DDBJ/EMBL/GenBank databases.
            Contact:Makiko Suwa
            Computational Biology Research Center (CBRC), National Institute
            of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
            Koto-ku, Tokyo 135-0064, Japan
            URL    :http://www.cbrc.jp/
REFERENCE   2
  AUTHORS   Suwa,M., Sato,T., Okouchi,I., Arita,M., Futami,K., Matsumoto,S.,
            Tsutsumi,S., Aburatani,H., Asai,K. and Akiyama,Y.
  TITLE     Genome-wide discovery and analysis of human seven transmembrane
            helix receptor genes.
  JOURNAL   Unpublished (2001)
COMMENT     This sequence is a seven transmembrane helix receptor candidate
            predicted from the whole human genome sequences using our
            automated system that contains programs of gene
            finding(GeneDecoder), sequence search, motif-domain assignment and
            transmembrane helix prediction.
            And the sequence is submitted by the collaborative project between
            [Computational Biology Research Center (CBRC), National Institute
            of Advanced Industrial Science and Technology (AIST)] and [Genome
            Science Division, Research Center for Advanced Science and
            Technology (RCAST), University of Tokyo].
FEATURES             Location/Qualifiers
     source          1..1294
                     /chromosome="18"
                     /db_xref="H-InvDB:HIT000383511"
                     /db_xref="taxon:9606"
                     /isolate="CBRC7TM_478"
                     /mol_type="genomic DNA"
                     /organism="Homo sapiens"
     CDS             201..1094
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /product="seven transmembrane helix receptor"
                     /protein_id="BAC06130.1"
                     /translation="MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLI
                     VLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTA
                     DDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTG
                     TGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGA
                     ITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIY
                     AFRSPELRDAFKKMIFCSRYW"
BASE COUNT          306 a          342 c          277 g          369 t
ORIGIN      
        1 tttaagcgag tgtggctggt ttttattttc tagtgtactt tgcaactaat atttctgtat
       61 actccctttt aggtgattgg gagattttaa cttagatctc cagcaagtgc tacaaggaag
      121 aaaagatcct gaagaatcaa tcaagttttc cgtgaagtca agtccaagta acatccccgc
      181 cttaaccaca agcaggagaa atgaagcaca ttatcaactc gtatgaaaac atcaacaaca
      241 cagcaagaaa taattccgac tgtcctcgtg tggttttgcc ggaggagata tttttcacaa
      301 tttccattgt tggagttttg gagaatctga tcgtcctgct ggctgtgttc aagaataaga
      361 atctccaggc acccatgtac tttttcatct gtagcttggc catatctgat atgctgggca
      421 gcctatataa gatcttggaa aatatcctga tcatattgag aaacatgggc tatctcaagc
      481 cacgtggcag ttttgaaacc acagccgatg acatcatcga ctccctgttt gtcctctccc
      541 tgcttggctc catcttcagc ctgtctgtga ttgctgcgga ccgctacatc accatcttcc
      601 acgcactgcg gtaccacagc atcgtgacca tgcgccgcac tgtggtggtg cttacggtca
      661 tctggacgtt ctgcacgggg actggcatca ccatggtgat cttctcccat catgtgccca
      721 cagtgatcac cttcacgtcg ctgttcccgc tgatgctggt cttcatcctg tgcctctatg
      781 tgcacatgtt cctgctggct cgatcccaca ccaggaagat ctccaccctc cccagagcca
      841 acatgaaagg ggccatcaca ctgaccatcc tgctcggggt cttcatcttc tgctgggccc
      901 cctttgtgct tcatgtcctc ttgatgacat tctgcccaag taacccctac tgcgcctgct
      961 acatgtctct cttccaggtg aacggcatgt tgatcatgtg caatgccgtc attgacccct
     1021 tcatatatgc cttccggagc ccagagctca gggacgcatt caaaaagatg atcttctgca
     1081 gcaggtactg gtagaatggc tgatccctgg ttttagaatc catgggaata acgttgccaa
     1141 gtgccagaat agtgtaacat tccaacaaat gccagtgctc ctcactggcc ttccttccct
     1201 aatggatgca aggatgatcc caccagctag tgtttctaat agctaggttc tatgtgaaca
     1261 gtcttattgt aggggcaacc tcttaacttt gtga
//