LOCUS AB065507 1075 bp DNA linear HUM 23-JUL-2002 DEFINITION Homo sapiens gene for seven transmembrane helix receptor, complete cds, isolate:CBRC7TM_70. ACCESSION AB065507 VERSION AB065507.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1075) AUTHORS Suwa,M. TITLE Direct Submission JOURNAL Submitted (11-JUL-2001) to the DDBJ/EMBL/GenBank databases. Contact:Makiko Suwa Computational Biology Research Center (CBRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi Koto-ku, Tokyo 135-0064, Japan URL :http://www.cbrc.jp/ REFERENCE 2 AUTHORS Suwa,M., Sato,T., Okouchi,I., Arita,M., Futami,K., Matsumoto,S., Tsutsumi,S., Aburatani,H., Asai,K. and Akiyama,Y. TITLE Genome-wide discovery and analysis of human seven transmembrane helix receptor genes. JOURNAL Unpublished (2001) COMMENT This sequence is a seven transmembrane helix receptor candidate predicted from the whole human genome sequences using our automated system that contains programs of gene finding(GeneDecoder), sequence search, motif-domain assignment and transmembrane helix prediction. And the sequence is submitted by the collaborative project between [Computational Biology Research Center (CBRC), National Institute of Advanced Industrial Science and Technology (AIST)] and [Genome Science Division, Research Center for Advanced Science and Technology (RCAST), University of Tokyo]. FEATURES Location/Qualifiers source 1..1075 /chromosome="11" /db_xref="H-InvDB:HIT000383203" /db_xref="taxon:9606" /isolate="CBRC7TM_70" /mol_type="genomic DNA" /organism="Homo sapiens" CDS 201..875 /codon_start=1 /inference="non-experimental evidence, no additional details recorded" /product="seven transmembrane helix receptor" /protein_id="BAC05755.1" /translation="MRNFSVVSEFILLGIPHTEGLETILLVLFLSFYIFTLMGNLLIL LAIVSSARLHTPMYFFLCKLSVFDLFFPSVSSPKMLCYLSGNSRAISYAGCASQLFFY HFLGCTECFLYTVMAYDRFVAICHPLRYTIIMSHRACIILAMGTSFFGCIQATFLTTL TFQLPYCVPNEVDYYFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSG IVFSIL" BASE COUNT 204 a 308 c 221 g 342 t ORIGIN 1 gactgactct aaaataggca tttccttatt atctgatttt tttttacatg gatctctctc 61 ttgcctttca taagaaggca ggttgttcct tgttaaaaac atagccaaag cactcatcag 121 caaaaagctt gagaacttga cattggtgtt tagactttgg tgtcttgggt accttttcaa 181 ggttggatgt tttcacagcc atgaggaatt tctcggtggt gtccgaattc atcctgctgg 241 gcatccctca cacggagggt ctggagacta ttctgttggt cctgtttttg tccttctaca 301 tcttcaccct tatggggaac ctgctcatct tgctggctat tgtctcctct gctcggcttc 361 acacgcccat gtacttcttc ctgtgcaagc tgtctgtttt tgacctattt ttcccttctg 421 tgagttcccc taagatgctg tgctatcttt cagggaacag ccgagccatc tcctatgcag 481 gctgtgcatc ccagctcttc ttctaccatt tcctgggctg cactgagtgt ttcctgtaca 541 cggtgatggc ctacgaccgc tttgttgcca tttgtcaccc tctacgctac accataatca 601 tgagccacag agcatgtatc atcctagcca tggggacctc attctttggc tgcattcagg 661 ccacctttct gaccactctc accttccaat tgccttactg tgtccccaat gaggtggact 721 attatttctg tgatatccca gtcatgctga agctggcttg tgcagatacc tcagccctgg 781 agatggtggg gttcatcagt gtgggcctca tgcccctcag ctgtttcctt ctcatcctca 841 cctcctacag tggcatcgtc ttctccatct tgtagatctg ctctgccgag ggccgacgcc 901 gtgccttctc cacctgcagc gcccacctca ccgccatcct gcttttttac atgccagtgg 961 tcctcattta cctgaggcct acccacagcc tgtggttgga tgcaactgtt caaattctga 1021 ataacctggt cacccccatg ctgaacccct taatctacag tctcaggaat aagga //