LOCUS       AB065507                1075 bp    DNA     linear   HUM 23-JUL-2002
DEFINITION  Homo sapiens gene for seven transmembrane helix receptor, complete
            cds, isolate:CBRC7TM_70.
ACCESSION   AB065507
VERSION     AB065507.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1075)
  AUTHORS   Suwa,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2001) to the DDBJ/EMBL/GenBank databases.
            Contact:Makiko Suwa
            Computational Biology Research Center (CBRC), National Institute
            of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
            Koto-ku, Tokyo 135-0064, Japan
            URL    :http://www.cbrc.jp/
REFERENCE   2
  AUTHORS   Suwa,M., Sato,T., Okouchi,I., Arita,M., Futami,K., Matsumoto,S.,
            Tsutsumi,S., Aburatani,H., Asai,K. and Akiyama,Y.
  TITLE     Genome-wide discovery and analysis of human seven transmembrane
            helix receptor genes.
  JOURNAL   Unpublished (2001)
COMMENT     This sequence is a seven transmembrane helix receptor candidate
            predicted from the whole human genome sequences using our
            automated system that contains programs of gene
            finding(GeneDecoder), sequence search, motif-domain assignment and
            transmembrane helix prediction.
            And the sequence is submitted by the collaborative project between
            [Computational Biology Research Center (CBRC), National Institute
            of Advanced Industrial Science and Technology (AIST)] and [Genome
            Science Division, Research Center for Advanced Science and
            Technology (RCAST), University of Tokyo].
FEATURES             Location/Qualifiers
     source          1..1075
                     /chromosome="11"
                     /db_xref="H-InvDB:HIT000383203"
                     /db_xref="taxon:9606"
                     /isolate="CBRC7TM_70"
                     /mol_type="genomic DNA"
                     /organism="Homo sapiens"
     CDS             201..875
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /product="seven transmembrane helix receptor"
                     /protein_id="BAC05755.1"
                     /translation="MRNFSVVSEFILLGIPHTEGLETILLVLFLSFYIFTLMGNLLIL
                     LAIVSSARLHTPMYFFLCKLSVFDLFFPSVSSPKMLCYLSGNSRAISYAGCASQLFFY
                     HFLGCTECFLYTVMAYDRFVAICHPLRYTIIMSHRACIILAMGTSFFGCIQATFLTTL
                     TFQLPYCVPNEVDYYFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSG
                     IVFSIL"
BASE COUNT          204 a          308 c          221 g          342 t
ORIGIN      
        1 gactgactct aaaataggca tttccttatt atctgatttt tttttacatg gatctctctc
       61 ttgcctttca taagaaggca ggttgttcct tgttaaaaac atagccaaag cactcatcag
      121 caaaaagctt gagaacttga cattggtgtt tagactttgg tgtcttgggt accttttcaa
      181 ggttggatgt tttcacagcc atgaggaatt tctcggtggt gtccgaattc atcctgctgg
      241 gcatccctca cacggagggt ctggagacta ttctgttggt cctgtttttg tccttctaca
      301 tcttcaccct tatggggaac ctgctcatct tgctggctat tgtctcctct gctcggcttc
      361 acacgcccat gtacttcttc ctgtgcaagc tgtctgtttt tgacctattt ttcccttctg
      421 tgagttcccc taagatgctg tgctatcttt cagggaacag ccgagccatc tcctatgcag
      481 gctgtgcatc ccagctcttc ttctaccatt tcctgggctg cactgagtgt ttcctgtaca
      541 cggtgatggc ctacgaccgc tttgttgcca tttgtcaccc tctacgctac accataatca
      601 tgagccacag agcatgtatc atcctagcca tggggacctc attctttggc tgcattcagg
      661 ccacctttct gaccactctc accttccaat tgccttactg tgtccccaat gaggtggact
      721 attatttctg tgatatccca gtcatgctga agctggcttg tgcagatacc tcagccctgg
      781 agatggtggg gttcatcagt gtgggcctca tgcccctcag ctgtttcctt ctcatcctca
      841 cctcctacag tggcatcgtc ttctccatct tgtagatctg ctctgccgag ggccgacgcc
      901 gtgccttctc cacctgcagc gcccacctca ccgccatcct gcttttttac atgccagtgg
      961 tcctcattta cctgaggcct acccacagcc tgtggttgga tgcaactgtt caaattctga
     1021 ataacctggt cacccccatg ctgaacccct taatctacag tctcaggaat aagga
//