LOCUS AB050193 1760 bp mRNA linear HUM 01-JUL-2008
DEFINITION Homo sapiens h-scot-t mRNA for succinyl CoA: 3-oxo acid CoA
transferase, complete cds.
ACCESSION AB050193
VERSION AB050193.2
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1760)
AUTHORS Kohroki,J. and Tanaka,H.
TITLE Direct Submission
JOURNAL Submitted (18-OCT-2000) to the DDBJ/EMBL/GenBank databases.
Contact:Hiromitsu Tanaka
Faculty of Pharmaceutical Sciences, Nagasaki International
University; Sasebo, Nagasaki 859-3298, Japan
REFERENCE 2
AUTHORS Tanaka,H., Kohroki,J., Iguchi,N., Onishi,M. and Nishimune,Y.
TITLE Cloning and characterization of a human orthologue of
testis-specific succinyl CoA: 3-oxo acid CoA transferase (Scot-t)
cDNA.
JOURNAL Mol. Hum. Reprod. 8, 16-23 (2002)
COMMENT
FEATURES Location/Qualifiers
source 1..1760
/cell_type="haploid germ cell"
/country="Japan"
/db_xref="H-InvDB:HIT000059551"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="SNP information was identified using a genomic DNA
of a blood"
/organism="Homo sapiens"
/sex="male"
/tissue_type="testis"
CDS 20..1573
/codon_start=1
/gene="h-scot-t"
/note="SCOT-t"
/note="haploid germ cell specific succinyl CoA
transferase"
/product="succinyl CoA: 3-oxo acid CoA transferase"
/protein_id="BAB40810.2"
/transl_table=1
/translation="MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYA
DPVEMVKDISDGATVMIGGFGLCGIPENLIAALLRTRVKDLQVVSSNVGVEDFGLGLL
LAARQVRRIVCSYVGENTLCESQYLAGELELELTPQGTLAERIRAGGAGVPAFYTPTG
YGTLVQEGGAPIRYTPDGHLALMSQPREVREFNGDHFLLERAIRADFALVKGWKADRA
GNVVFRRSARNFNVPMCKAADVTAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYE
KRIERLTILKEEDGDAGKEEDARTRIIRRAALEFEDGMYANLGIGIPLLASNFISPSM
TVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTVLPGGCFFASDDSFAMIRGGHIQ
LTMLGAMQVSKYGDLANWMIPGKKVKGMGGAMDLVSSQKTRVVVTMQHCTKDNTPKIM
EKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPN
LRPMQQVAP"
variation 132
/note="SNP information"
/note="This substitution causes an amino acid
substitution from Leu to Pro"
/replace="c"
variation 280
/note="SNP information in Australian"
/note="This substitution dose not cause an amino acid"
/replace="a"
variation 873
/note="SNP information"
/note="This substitution causes an amino acid
substitution from Leu to Arg"
/replace="g"
variation 1002
/note="SNP information in Australian"
/note="This substitution causes an amino acid
substitution from Asn to Ser"
/replace="g"
variation 1074
/note="SNP information"
/note="This substitution causes an amino acid
substitution from Thr to Met"
/replace="t"
variation 1395
/note="SNP information"
/note="This substitution causes an amino acid
substitution from Gly to Val"
/replace="t"
variation 1458
/note="SNP information"
/note="This substitution causes an amino acid
substitution from Glu to Gly"
/replace="g"
variation 1499
/note="SNP information"
/note="This substitution causes an amino acid
substitution from Asp to Asn"
/replace="a"
variation 1616
/note="3'UTR"
/note="SNP information"
/replace="a"
variation 1670
/note="3'UTR"
/note="SNP information"
/replace="c"
BASE COUNT 368 a 519 c 581 g 292 t
ORIGIN
1 gggccgaccc gggccgacta tggcggcgct gcggctcctg gcgtcagtgc tcgggcgcgg
61 ggtccccgcc ggcggctcag ggctcgcgct gtcccagggc tgcgcccgct gctttgccac
121 cagtccccgg ctccgtgcca agttctacgc ggacccggtg gagatggtga aggacatctc
181 tgacggggcg accgtcatga tcgggggctt cgggctctgc gggatccccg agaacctgat
241 cgccgcgctg ctcaggaccc gcgtgaaaga cctgcaggtg gtcagcagca acgtgggcgt
301 ggaggacttc ggcctgggcc tcctgctggc cgccaggcag gtccgtcgca tcgtctgttc
361 ctacgtgggc gagaacaccc tgtgcgagag ccagtacctg gcaggagagc tggagctgga
421 gctcacgccc cagggcaccc tggccgagcg catccgcgcg gggggcgccg gggtgcccgc
481 cttctacacc cccacgggct acgggaccct ggtccaggaa gggggcgccc ccatccgcta
541 caccccggac ggccacctgg cgctcatgag ccagccccga gaggtgaggg agttcaacgg
601 cgaccacttc cttttggagc gcgccatccg ggcagacttc gccctggtga aagggtggaa
661 ggccgaccgg gcaggaaacg tggtcttcag gagaagcgcc cgcaatttca acgtgcccat
721 gtgcaaagct gcagacgtca cggcggtgga ggtggaagag atcgtggagg tgggggcttt
781 ccccccagaa gacatccacg ttcctaacat ttatgtagat cgcgtgataa aggggcagaa
841 atacgagaaa cgaattgagc gcttaacgat cctgaaagag gaagatggag acgctggaaa
901 ggaagaggac gccaggacgc gcatcatcag acgcgcagct ctggaatttg aggacggcat
961 gtacgccaat ctgggcatag gcatccccct gctggccagc aacttcatca gtcccagcat
1021 gactgtccat cttcacagtg agaacgggat cctgggcctg ggcccgtttc ccacggaaga
1081 tgaggtggat gccgacctca tcaatgcagg caagcagacg gtcacggtgc ttcccggggg
1141 ctgcttcttc gccagcgacg actccttcgc catgatccga gggggacaca tccaactaac
1201 catgcttgga gccatgcagg tttccaaata cggcgacctg gcgaactgga tgatccctgg
1261 caagaaggtg aaaggcatgg gcggtgccat ggacttggtg tccagtcaga agaccagagt
1321 ggtggtcacc atgcagcact gcacaaagga caacaccccc aagatcatgg agaaatgcac
1381 catgccgctg accgggaagc ggtgcgtgga ccgcatcatc accgagaagg ccgtgtttga
1441 cgtgcacagg aagaaagagc tgacgctgag ggagctctgg gagggcctga cggtggacga
1501 catcaaaaag agcacggggt gtgcctttgc tgtgtccccg aacctcaggc ccatgcagca
1561 ggtggcaccc tgacgggacc tggatctggg cggggtggtg cgctcctcag ggcgggtgcc
1621 accgggttcc ccaggggaat acatgtcccc agctctggga ggggtttgct actggcctcc
1681 tactttcctc cctaggtgga cagtgctcct ctagagagct gcgactttaa ttaaaaacaa
1741 caggaaaaca gaaaaaaaaa
//