LOCUS AB028128 380 bp mRNA linear HUM 02-FEB-2001 DEFINITION Homo sapiens DPM3 mRNA for dolichol-phosphate-mannose synthase, complete cds. ACCESSION AB028128 VERSION AB028128.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 380) AUTHORS Kinoshita,T. and Maeda,Y. TITLE Direct Submission JOURNAL Submitted (25-MAY-1999) to the DDBJ/EMBL/GenBank databases. Contact:Taroh Kinoshita Research Institute for Microbial Diseases, Osaka University, Department of Immunoregulation; 3-1 Yamada-oka, Suita, Osaka 565-0871, Japan REFERENCE 2 AUTHORS Maeda,Y., Tanaka,S., Hino,J., Kangawa,K. and Kinoshita,T. TITLE Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3 JOURNAL EMBO J. 19, 2475-2482 (2000) REFERENCE 3 AUTHORS Maeda,Y., Watanabe,R., Harris,C.L., Hong,Y., Ohishi,K., Kinoshita,K. and Kinoshita,T. TITLE PIG-M transfers the first mannose to glycosylphosphatidylinositol on the lumenal side of the ER JOURNAL EMBO J. 20, 250-261 (2001) COMMENT FEATURES Location/Qualifiers source 1..380 /db_xref="H-InvDB:HIT000058923" /db_xref="taxon:9606" /mol_type="mRNA" /note="This sequence was obtained from a EST clone (R97442)" /organism="Homo sapiens" CDS 18..296 /codon_start=1 /gene="DPM3" /product="dolichol-phosphate-mannose synthase" /protein_id="BAA96291.1" /transl_table=1 /translation="MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAY LLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGVRF" polyA_site 365 /note="15 a nucleotides" BASE COUNT 74 a 114 c 112 g 80 t ORIGIN 1 ggtggggtag agtgaccatg acgaaattag cgcagtggct ttggggacta gcgatcctgg 61 gctccacctg ggtggccctg accacgggag ccttgggcct ggagctgccc ttgtcctgcc 121 aggaagtcct gtggccactg cccgcctact tgctggtgtc cgccggctgc tatgccctgg 181 gcactgtggg ctatcgtgtg gccacttttc atgactgcga ggacgccgca cgcgagctgc 241 agagccagat acaggaggcc cgagccgact tagcccgcag gggcgtgcgc ttctgacagc 301 ctaaccccat tcctgtgcgg acagcccttc ctcccatttc ccattaaaga gccagtttat 361 tttctaaaaa aaaaaaaaaa //