LOCUS       AB028128                 380 bp    mRNA    linear   HUM 02-FEB-2001
DEFINITION  Homo sapiens DPM3 mRNA for dolichol-phosphate-mannose synthase,
            complete cds.
ACCESSION   AB028128
VERSION     AB028128.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 380)
  AUTHORS   Kinoshita,T. and Maeda,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-MAY-1999) to the DDBJ/EMBL/GenBank databases.
            Contact:Taroh Kinoshita
            Research Institute for Microbial Diseases, Osaka University,
            Department of Immunoregulation; 3-1 Yamada-oka, Suita, Osaka
            565-0871, Japan
REFERENCE   2
  AUTHORS   Maeda,Y., Tanaka,S., Hino,J., Kangawa,K. and Kinoshita,T.
  TITLE     Human dolichol-phosphate-mannose synthase consists of three
            subunits, DPM1, DPM2 and DPM3
  JOURNAL   EMBO J. 19, 2475-2482 (2000)
REFERENCE   3
  AUTHORS   Maeda,Y., Watanabe,R., Harris,C.L., Hong,Y., Ohishi,K.,
            Kinoshita,K. and Kinoshita,T.
  TITLE     PIG-M transfers the first mannose to glycosylphosphatidylinositol
            on the lumenal side of the ER
  JOURNAL   EMBO J. 20, 250-261 (2001)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..380
                     /db_xref="H-InvDB:HIT000058923"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="This sequence was obtained from a EST clone
                     (R97442)"
                     /organism="Homo sapiens"
     CDS             18..296
                     /codon_start=1
                     /gene="DPM3"
                     /product="dolichol-phosphate-mannose synthase"
                     /protein_id="BAA96291.1"
                     /transl_table=1
                     /translation="MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAY
                     LLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGVRF"
     polyA_site      365
                     /note="15 a nucleotides"
BASE COUNT           74 a          114 c          112 g           80 t
ORIGIN      
        1 ggtggggtag agtgaccatg acgaaattag cgcagtggct ttggggacta gcgatcctgg
       61 gctccacctg ggtggccctg accacgggag ccttgggcct ggagctgccc ttgtcctgcc
      121 aggaagtcct gtggccactg cccgcctact tgctggtgtc cgccggctgc tatgccctgg
      181 gcactgtggg ctatcgtgtg gccacttttc atgactgcga ggacgccgca cgcgagctgc
      241 agagccagat acaggaggcc cgagccgact tagcccgcag gggcgtgcgc ttctgacagc
      301 ctaaccccat tcctgtgcgg acagcccttc ctcccatttc ccattaaaga gccagtttat
      361 tttctaaaaa aaaaaaaaaa
//