LOCUS AB012623 167 bp DNA linear HUM 18-SEP-2008 DEFINITION Homo sapiens RHD gene for Rh blood group antigen, partial cds, allele: Dva (kou) type. ACCESSION AB012623 VERSION AB012623.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 167) AUTHORS Omi,T., Tani,Y. and Kajii,E. TITLE Direct Submission JOURNAL Submitted (27-MAR-1998) to the DDBJ/EMBL/GenBank databases. Contact:Toshinori Omi Jichi Medical School, Deprtment of Legal Medicine and Human Genetics; 3311-1 Minamikawachi-machi, Kawachi-gun, Tochigi 329-0498, Japan REFERENCE 2 AUTHORS Omi,T., Takahashi,J., Tsudo,N., Okuda,H., Iwamoto,S., Tanaka,M., Seno,T., Tani,Y. and Kajii,E. TITLE The genomic organization of the partial D category DVa: The presence of a new partial D associated with the DVa phenotype JOURNAL Biochem. Biophys. Res. Commun. 254, 786-794 (1999) COMMENT FEATURES Location/Qualifiers source 1..167 /chromosome="1" /db_xref="taxon:9606" /map="1p36-p34" /mol_type="genomic DNA" /organism="Homo sapiens" exon 1..167 /number=5 CDS <1..>167 /codon_start=3 /gene="RHD" /note="allele: Dva (kou) type" /product="Rh blood group antigen" /protein_id="BAA32804.1" /translation="ALFLWMFWPSVNSALLRSPIQRKNAVFNTYYAVAVSVVTAISGS SLAHPQGKISK" BASE COUNT 39 a 47 c 42 g 39 t ORIGIN 1 gcgccctctt cttgtggatg ttctggccaa gtgtcaactc tgctctgctg agaagtccaa 61 tccaaaggaa gaatgccgtg ttcaacacct actatgctgt agcagtcagc gtggtgacag 121 ccatctcagg gtcatccttg gctcaccccc aagggaagat cagcaag //