LOCUS       AB012623                 167 bp    DNA     linear   HUM 18-SEP-2008
DEFINITION  Homo sapiens RHD gene for Rh blood group antigen, partial cds,
            allele: Dva (kou) type.
ACCESSION   AB012623
VERSION     AB012623.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 167)
  AUTHORS   Omi,T., Tani,Y. and Kajii,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAR-1998) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshinori Omi
            Jichi Medical School, Deprtment of Legal Medicine and Human
            Genetics; 3311-1 Minamikawachi-machi, Kawachi-gun, Tochigi
            329-0498, Japan
REFERENCE   2
  AUTHORS   Omi,T., Takahashi,J., Tsudo,N., Okuda,H., Iwamoto,S., Tanaka,M.,
            Seno,T., Tani,Y. and Kajii,E.
  TITLE     The genomic organization of the partial D category DVa: The
            presence of a new partial D associated with the DVa phenotype
  JOURNAL   Biochem. Biophys. Res. Commun. 254, 786-794 (1999)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..167
                     /chromosome="1"
                     /db_xref="taxon:9606"
                     /map="1p36-p34"
                     /mol_type="genomic DNA"
                     /organism="Homo sapiens"
     exon            1..167
                     /number=5
     CDS             <1..>167
                     /codon_start=3
                     /gene="RHD"
                     /note="allele: Dva (kou) type"
                     /product="Rh blood group antigen"
                     /protein_id="BAA32804.1"
                     /translation="ALFLWMFWPSVNSALLRSPIQRKNAVFNTYYAVAVSVVTAISGS
                     SLAHPQGKISK"
BASE COUNT           39 a           47 c           42 g           39 t
ORIGIN      
        1 gcgccctctt cttgtggatg ttctggccaa gtgtcaactc tgctctgctg agaagtccaa
       61 tccaaaggaa gaatgccgtg ttcaacacct actatgctgt agcagtcagc gtggtgacag
      121 ccatctcagg gtcatccttg gctcaccccc aagggaagat cagcaag
//