LOCUS       Z21945                  1143 bp    DNA     linear   BCT 10-JAN-2009
DEFINITION  Pseudomonas chlororaphis subsp. aureofaciens nirK gene encoding
            copper-containing nitrite reductase.
ACCESSION   Z21945
VERSION     Z21945.1
KEYWORDS    copper-containing nitrite reductase; nirK gene; nitrite reductase
            (cytochrome).
SOURCE      Pseudomonas chlororaphis subsp. aureofaciens
  ORGANISM  Pseudomonas chlororaphis subsp. aureofaciens
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1
  AUTHORS   Glockner A.B., Juengst A., Zumft W.G.
  TITLE     Copper-containing nitrite reductase from Pseudomonas aureofaciens
            is functional in a mutationally cytochrome cd1-free background
            (NirS-) of Pseudomonas stutzeri
  JOURNAL   Arch. Microbiol. 160(1), 18-26(1993).
   PUBMED   8352648
REFERENCE   2  (bases 1 to 1143)
  AUTHORS   Zumft W.G.
  JOURNAL   Submitted (09-MAR-1993) to the INSDC. Zumft W. G., Universitaet
            Karlsruhe, Department of Microbiology, Kaiserstrasse 12, Karlsruhe,
            Germany, D-76128
FEATURES             Location/Qualifiers
     source          1..1143
                     /organism="Pseudomonas chlororaphis subsp. aureofaciens"
                     /sub_species="aureofaciens"
                     /strain="ATCC 13985"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:587851"
     regulatory      2..5
                     /citation=[1]
                     /regulatory_class="ribosome_binding_site"
     regulatory      13..84
                     /function="export signal for protein transport"
                     /note="presequence specifies an export signal for
                     translocation of the nitrite reductase into the periplasm"
                     /citation=[1]
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /regulatory_class="other"
     CDS             13..1104
                     /transl_table=11
                     /gene="nirK"
                     /standard_name="nitrite reductase (cytochrome)"
                     /product="copper-containing nitrite reductase"
                     /function="respiratory oxidoreductase of bacterial
                     denitrification"
                     /EC_number="1.7.2.1"
                     /note="nirK encodes the copper-containing, blue type I
                     nitrite reductase. The gene product has both type I and
                     type II copper-binding sites"
                     /db_xref="GOA:Q06006"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR001287"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/Swiss-Prot:Q06006"
                     /citation=[1]
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAA79939.1"
                     /translation="MSVFRSVLGACVLLGSCASSLALAGGAEGLQRVKVDLVAPPLVH
                     PHEQVVSGPPKVVQFRMSIEEKKMVIDDQGTTLQAMTFNGSMPGPTLVVHEGDYIELT
                     LVNPATNSMPHNVDFHAATGALGGAGLTQVVPGQEVVLRFKADRSGTFVYHCAPQGMV
                     PWHVVSGMNGALMVLPRDGLRDPQGKLLHYDRVYTIGESDLYIPKDKDGHYKDYPDLA
                     SSYQDTRAVMRTLTPSHVVFNGRVGALTGANALTSKVGESVLFIHSQANRDSRPHLIG
                     GHGDWVWTTGKFANPPQRNMETWFIPGGSAVAALYTFKQPGTYVYLSHNLIEAMELGA
                     LAQIKVEGQWDDDLMTQVKAPGPIVEPKQ"
BASE COUNT          213 a          358 c          378 g          194 t
ORIGIN      
        1 cgggattctg caatgagtgt ttttcgaagt gtattggggg cctgtgtgct gcttggcagc
       61 tgtgccagca gcctggcgct ggccggtggg gccgagggtt tgcagcgggt gaaggtcgac
      121 ctggtcgcgc cgccgctggt gcatccccat gagcaggtgg tcagcgggcc gcccaaggtg
      181 gtgcagttcc gcatgagtat cgaagagaaa aaaatggtca tcgacgacca gggcaccacg
      241 ctccaggcca tgaccttcaa tggctccatg cccggcccga ccctggtggt gcatgagggt
      301 gactatatag agctgacgct ggtcaatccg gcgaccaaca gcatgcccca taacgtcgac
      361 tttcacgcgg ccaccggcgc cctgggcggg gcgggcctga cccaggtggt gccagggcag
      421 gaagtggtcc tgcgcttcaa ggccgaccgc agcggcacct ttgtctacca ctgcgcgccg
      481 caaggcatgg tgccgtggca cgtggtgtcg ggcatgaacg gcgcgctgat ggtgctgccc
      541 cgtgacggcc tgcgcgaccc gcagggcaaa ctcctgcatt acgaccgcgt ctacaccatc
      601 ggcgagtccg acctgtatat ccccaaggac aaggacggcc actacaagga ctacccggac
      661 ctggcgtcca gttaccagga cacccgcgcg gtcatgcgca ccctgacccc gagccacgtg
      721 gtgttcaacg gccgtgtcgg cgccctgacc ggggccaacg cgctgacctc caaggtcggg
      781 gagagcgtgc tgttcatcca ctcccaggcc aaccgcgaca gccgtccgca cctgattggc
      841 ggccacggcg actgggtctg gaccaccggc aagttcgcca acccgccgca acgcaacatg
      901 gaaacctggt ttatccctgg cggttctgcg gtggcggcgc tgtacacctt caagcagccg
      961 gggacctacg tgtacctcag ccataacctg atcgaggcca tggaactggg ggccctggcc
     1021 cagatcaagg tggaggggca gtgggacgat gacctgatga cccaggtgaa agcgccaggg
     1081 ccgatcgtcg agcccaagca gtagtaagag gggcggggat attgctcagg tcttgatcat
     1141 ttc
//