LOCUS Z21945 1143 bp DNA linear BCT 10-JAN-2009 DEFINITION Pseudomonas chlororaphis subsp. aureofaciens nirK gene encoding copper-containing nitrite reductase. ACCESSION Z21945 VERSION Z21945.1 KEYWORDS copper-containing nitrite reductase; nirK gene; nitrite reductase (cytochrome). SOURCE Pseudomonas chlororaphis subsp. aureofaciens ORGANISM Pseudomonas chlororaphis subsp. aureofaciens Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 AUTHORS Glockner A.B., Juengst A., Zumft W.G. TITLE Copper-containing nitrite reductase from Pseudomonas aureofaciens is functional in a mutationally cytochrome cd1-free background (NirS-) of Pseudomonas stutzeri JOURNAL Arch. Microbiol. 160(1), 18-26(1993). PUBMED 8352648 REFERENCE 2 (bases 1 to 1143) AUTHORS Zumft W.G. JOURNAL Submitted (09-MAR-1993) to the INSDC. Zumft W. G., Universitaet Karlsruhe, Department of Microbiology, Kaiserstrasse 12, Karlsruhe, Germany, D-76128 FEATURES Location/Qualifiers source 1..1143 /organism="Pseudomonas chlororaphis subsp. aureofaciens" /sub_species="aureofaciens" /strain="ATCC 13985" /mol_type="genomic DNA" /db_xref="taxon:587851" regulatory 2..5 /citation=[1] /regulatory_class="ribosome_binding_site" regulatory 13..84 /function="export signal for protein transport" /note="presequence specifies an export signal for translocation of the nitrite reductase into the periplasm" /citation=[1] /experiment="experimental evidence, no additional details recorded" /regulatory_class="other" CDS 13..1104 /transl_table=11 /gene="nirK" /standard_name="nitrite reductase (cytochrome)" /product="copper-containing nitrite reductase" /function="respiratory oxidoreductase of bacterial denitrification" /EC_number="1.7.2.1" /note="nirK encodes the copper-containing, blue type I nitrite reductase. The gene product has both type I and type II copper-binding sites" /db_xref="GOA:Q06006" /db_xref="InterPro:IPR001117" /db_xref="InterPro:IPR001287" /db_xref="InterPro:IPR008972" /db_xref="InterPro:IPR011707" /db_xref="UniProtKB/Swiss-Prot:Q06006" /citation=[1] /experiment="experimental evidence, no additional details recorded" /protein_id="CAA79939.1" /translation="MSVFRSVLGACVLLGSCASSLALAGGAEGLQRVKVDLVAPPLVH PHEQVVSGPPKVVQFRMSIEEKKMVIDDQGTTLQAMTFNGSMPGPTLVVHEGDYIELT LVNPATNSMPHNVDFHAATGALGGAGLTQVVPGQEVVLRFKADRSGTFVYHCAPQGMV PWHVVSGMNGALMVLPRDGLRDPQGKLLHYDRVYTIGESDLYIPKDKDGHYKDYPDLA SSYQDTRAVMRTLTPSHVVFNGRVGALTGANALTSKVGESVLFIHSQANRDSRPHLIG GHGDWVWTTGKFANPPQRNMETWFIPGGSAVAALYTFKQPGTYVYLSHNLIEAMELGA LAQIKVEGQWDDDLMTQVKAPGPIVEPKQ" BASE COUNT 213 a 358 c 378 g 194 t ORIGIN 1 cgggattctg caatgagtgt ttttcgaagt gtattggggg cctgtgtgct gcttggcagc 61 tgtgccagca gcctggcgct ggccggtggg gccgagggtt tgcagcgggt gaaggtcgac 121 ctggtcgcgc cgccgctggt gcatccccat gagcaggtgg tcagcgggcc gcccaaggtg 181 gtgcagttcc gcatgagtat cgaagagaaa aaaatggtca tcgacgacca gggcaccacg 241 ctccaggcca tgaccttcaa tggctccatg cccggcccga ccctggtggt gcatgagggt 301 gactatatag agctgacgct ggtcaatccg gcgaccaaca gcatgcccca taacgtcgac 361 tttcacgcgg ccaccggcgc cctgggcggg gcgggcctga cccaggtggt gccagggcag 421 gaagtggtcc tgcgcttcaa ggccgaccgc agcggcacct ttgtctacca ctgcgcgccg 481 caaggcatgg tgccgtggca cgtggtgtcg ggcatgaacg gcgcgctgat ggtgctgccc 541 cgtgacggcc tgcgcgaccc gcagggcaaa ctcctgcatt acgaccgcgt ctacaccatc 601 ggcgagtccg acctgtatat ccccaaggac aaggacggcc actacaagga ctacccggac 661 ctggcgtcca gttaccagga cacccgcgcg gtcatgcgca ccctgacccc gagccacgtg 721 gtgttcaacg gccgtgtcgg cgccctgacc ggggccaacg cgctgacctc caaggtcggg 781 gagagcgtgc tgttcatcca ctcccaggcc aaccgcgaca gccgtccgca cctgattggc 841 ggccacggcg actgggtctg gaccaccggc aagttcgcca acccgccgca acgcaacatg 901 gaaacctggt ttatccctgg cggttctgcg gtggcggcgc tgtacacctt caagcagccg 961 gggacctacg tgtacctcag ccataacctg atcgaggcca tggaactggg ggccctggcc 1021 cagatcaagg tggaggggca gtgggacgat gacctgatga cccaggtgaa agcgccaggg 1081 ccgatcgtcg agcccaagca gtagtaagag gggcggggat attgctcagg tcttgatcat 1141 ttc //