LOCUS       X65277                  2760 bp    DNA     linear   BCT 14-NOV-2006
DEFINITION  Pseudomonas aeruginosa nosZ, nosD and nosR genes, strain DSM 50071.
ACCESSION   X65277
VERSION     X65277.1
KEYWORDS    nitrous-oxide reductase; nosD gene; nosR gene; nosZ gene.
SOURCE      Pseudomonas aeruginosa
  ORGANISM  Pseudomonas aeruginosa
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 2760)
  AUTHORS   Zumft W.G., Dreusch A., Lochelt S., Cuypers H., Friedrich B.,
            Schneider B.
  TITLE     Derived amino acid sequences of the nosZ gene (respiratory N2O
            reductase) from Alcaligenes eutrophus, Pseudomonas aeruginosa and
            Pseudomonas stutzeri reveal potential copper-binding residues.
            Implications for the CuA site of N2O reductase and cytochrome-c
            oxidase
  JOURNAL   Eur. J. Biochem. 208(1), 31-40(1992).
   PUBMED   1324835
REFERENCE   2  (bases 1 to 2760)
  AUTHORS   Zumft W.G., Viebrock-Sambale A., Braun C.
  TITLE     Nitrous oxide reductase from denitrifying Pseudomonas stutzeri.
            Genes for copper-processing and properties of the deduced products,
            including a new member of the family of ATP/GTP-binding proteins
  JOURNAL   Eur. J. Biochem. 192(3), 591-599(1990).
   PUBMED   2170125
REFERENCE   4  (bases 1 to 2760)
  AUTHORS   Zumft W.G.
  JOURNAL   Submitted (25-JUN-1992) to the INSDC. Zumft W. G., Universitaet
            Karlsruhe, Department of Microbiology, Kaiserstrasse 12, D-76128,
            Karlsruhe, GERMANY
FEATURES             Location/Qualifiers
     source          1..2760
                     /organism="Pseudomonas aeruginosa"
                     /strain="DSM 50071"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:287"
     CDS             <1..303
                     /codon_start=1
                     /transl_table=11
                     /gene="nosR"
                     /product="NosR protein"
                     /function="regulatory protein for nitrous oxide reductase
                     expression"
                     /note="Derived protein fragment is homologous to the
                     C-terminus of a regulatory component from Pseudomonas
                     stutzeri (Cuypers et al.,1992)"
                     /db_xref="GOA:Q01709"
                     /db_xref="UniProtKB/Swiss-Prot:Q01709"
                     /protein_id="CAA46380.1"
                     /translation="CRYICPLGAALAIPSKFRLFDWLKRRKECGNPCQLCAKECEIQA
                     IHPDGRINGNECHYCLDCQMTYHNDNKCPPLINKRKKRGKKAADPQLIPAVEVSDA"
     stem_loop       289..332
                     /function="putative transcriptional terminator"
     regulatory      348..354
                     /regulatory_class="ribosome_binding_site"
     CDS             359..2263
                     /transl_table=11
                     /gene="nosZ"
                     /product="nitrous-oxide reductase"
                     /function="respiratory oxidoreductase of denitrification"
                     /EC_number="1.7.99.6"
                     /db_xref="GOA:Q01710"
                     /db_xref="InterPro:IPR001505"
                     /db_xref="InterPro:IPR002429"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011045"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR023644"
                     /db_xref="InterPro:IPR034205"
                     /db_xref="InterPro:IPR041114"
                     /db_xref="InterPro:IPR041142"
                     /db_xref="UniProtKB/Swiss-Prot:Q01710"
                     /protein_id="CAA46381.1"
                     /translation="MSDKQTDKDEKTGLSRRGFLGASALTRSAVAASGLVGGVMTRDS
                     WAAAAKEAQQKIHVAPGELDEYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATG
                     WGLTNESRHILGDTAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMK
                     CDKITTIPNVQAIHGLRLQKVPHTKYVFCNAEFIIPHPNDGKVFDLEDENSFTMYNAV
                     DAETMEVAFQVIVDGNLDNTDADYTGRFTAATCYNSEKAFDLGGMMRNERDWVVVFDI
                     SAVEKEIKAGRFITLGDSKVPVVDGRKKDGKDSVVTRYIPVPKNPHGLNTSTDGKYFI
                     ANGKLSPTCSMIAIDLLPDLFAGKLKDPRDVVVGEPELGLGPLHTTFDGRGNAYTTLF
                     IDSQVVKWNMEEARRAYKGEKVNYIKQKLDVHYQPGHLHASLCETSEADGKWLVALSK
                     FSKDRFLPTGPLHPENDQLIDISGDVMKLVHDGPTFAEPHDCIMARRDQIKTRKIWDR
                     NDPFFAPTVAMAKKDGINLEEDNKVIRDGNKVRVYMTSMAPAYGLTEFKVKQGNEVTV
                     VITNMDQIEDVSHGFVMVNHGVSMEISPQQTSSITFIADKPGLHWYYCSWFCHALHME
                     MVGRMMVEPA"
     misc_feature    2084..2233
                     /function="putative copper-binding site"
                     /note="label:CuA-site"
                     /note="this domain shows structural similarity to the
                     putative CuA-binding site of the subunit II of cytochrome
                     c oxidase, EC 1.9.3.1"
     stem_loop       2267..2299
                     /function="putative transcriptional terminator"
     regulatory      2422..2425
                     /regulatory_class="ribosome_binding_site"
     CDS             2434..>2760
                     /transl_table=11
                     /gene="nosD"
                     /product="NosD protein"
                     /function="copper-processing component"
                     /note="derived protein fragment is homologous to the
                     N-terminus of a protein from Pseudomonas stutzeri involved
                     in copper processing (Zumft et al.,1990)"
                     /db_xref="GOA:Q01708"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="UniProtKB/Swiss-Prot:Q01708"
                     /protein_id="CAA46382.1"
                     /translation="MIRYTKLPATCAVLLLAAGSVMAQVQPISTLPLQAQGENRWLLP
                     AGEYHGQFVIDQPMQLRCAAGACCGPTGQGSALIIEASDVSVEGCTLLNWGRDLTAMD
                     AGVHIAA"
BASE COUNT          572 a          910 c          841 g          437 t
ORIGIN      
        1 tgccgctaca tctgcccgct gggcgctgcc ctggcgatcc ccagcaagtt ccgcctgttc
       61 gactggctca agcgccgcaa ggaatgcggc aacccctgcc agctgtgcgc caaagagtgc
      121 gagatccagg ccatccaccc ggacggtcgc atcaacggca acgagtgcca ctactgcctc
      181 gactgccaga tgacctacca caacgacaac aaatgcccgc cgctgatcaa caagcgcaag
      241 aagcgcggca agaaggctgc cgacccacaa ctgattcccg ccgtcgaggt gagcgatgcc
      301 tgaccacgag ccgaaccggg ctcgcggcag gcgtgttatt tcccaacagg agcgacccat
      361 gagcgacaag caaactgata aggatgaaaa aaccggtctg agccggcgcg gctttcttgg
      421 cgccagcgca cttaccaggt cggccgtggc ggccagtggc ctggtcggtg gggtgatgac
      481 ccgcgacagc tgggcagcgg ctgccaagga ggcgcagcag aagatccatg tcgcccccgg
      541 cgagctggac gagtactacg gcttctggag cggtggtcac cagggcgagg tgcgcgtgct
      601 cggcgtgccg tcgatgcgcg agctgatgcg catcccggtg ttcaacgtcg attcggcgac
      661 cggctggggc ctgaccaacg agagccggca catcctcggc gacacggcca agttcctcaa
      721 cggcgactgc caccacccgc atatctccat gaccgacggc aagtacgacg gcaagtacct
      781 gttcatcaac gacaaggcca acagccgcgt cgcgcgtatc cgcctggaca tcatgaagtg
      841 cgacaagatc accaccatcc ccaacgtcca ggccatccat ggcctgcgct tgcagaaggt
      901 gccgcacacc aagtacgtgt tctgcaacgc cgagttcatc atcccgcacc ccaatgacgg
      961 caaggtcttc gacctcgagg acgagaacag cttcaccatg tacaacgccg tggatgccga
     1021 gaccatggaa gtcgccttcc aggtcatcgt cgacggcaat ctcgacaaca ccgatgccga
     1081 ctacaccggc cgtttcaccg ccgccacctg ctacaactcg gagaaggcct tcgacctcgg
     1141 cggcatgatg cgcaacgagc gcgactgggt ggtggtgttc gacatctcgg cggtggagaa
     1201 ggagatcaag gctggccgct tcatcaccct cggcgactcc aaggtgccgg tggtcgacgg
     1261 gcgcaagaag gacggcaagg acagcgtggt gacccgctac attccggtgc cgaagaaccc
     1321 gcacggcctg aacacttcca ccgacggcaa gtacttcatc gccaacggca agctgtcgcc
     1381 gacctgctcg atgatcgcca tcgacctgct gcccgacctg ttcgccggca agctcaagga
     1441 cccgcgtgac gtggtggtcg gcgagcccga gctgggcctt ggcccgctgc acaccacctt
     1501 cgatggtcgc ggcaacgcct acaccacgct gttcatcgac agccaggtgg tcaagtggaa
     1561 catggaggag gcccgtcgcg cctacaaggg cgagaaggtc aactacatca agcagaagct
     1621 tgacgtgcac taccagccgg gtcacctgca cgcctcgctg tgcgaaacca gcgaagccga
     1681 tggcaaatgg ctggtggcgc tgtcgaagtt ctccaaggac cgcttcctgc ccaccggccc
     1741 gctgcacccg gagaatgacc agttgatcga catctccggc gacgtgatga agctggtgca
     1801 tgacggcccg accttcgccg aaccgcatga ctgcatcatg gcccgccgcg accagatcaa
     1861 gacgcgcaag atctgggacc gcaacgaccc tttcttcgcc ccgaccgtgg ccatggccaa
     1921 gaaggacggc atcaacctgg aggaggacaa caaggtcatc cgcgatggca acaaggtgcg
     1981 cgtgtacatg acctccatgg cgcccgccta tggtctgacc gaattcaagg tcaagcaggg
     2041 caatgaagtc accgtggtga tcaccaacat ggaccagatc gaggacgtgt cccacggctt
     2101 cgtcatggtc aaccacggcg tgagcatgga gatcagcccg cagcagacct cgtcgatcac
     2161 cttcatcgcc gacaagcccg gcctgcactg gtactactgc agctggttct gccacgcgct
     2221 gcacatggag atggtcggcc gcatgatggt cgagccggcc tgatgccggg gccggggagg
     2281 attgccttcc ccggcctcgt attgagcttc agcgtgggag cgacgggggc gcctagcctt
     2341 gtccgcgaat gcttgtggat aaacgttcgc ggagccccgt cgcttccaca aaacgtgatg
     2401 cagcgtacga acaggtggac gaaggtaagt gcagtgatcc gatataccaa gctccccgcg
     2461 acctgcgccg tgcttttgct cgctgcaggc tccgtcatgg cacaggtgca gcccatctcg
     2521 accctgccgc tgcaggcgca gggcgagaac cgctggctgc tgccggcggg cgagtaccac
     2581 gggcagttcg tcatcgacca gcccatgcaa ctgcgttgtg cggccggcgc gtgctgcggg
     2641 ccgaccgggc agggcagcgc gttgatcatc gaagccagcg acgtcagcgt cgaaggctgc
     2701 accctcctca actgggggcg cgatctcacc gccatggatg ccggcgtgca tatcgccgcg
//